Recombinant Human RGS2 protein, T7-tagged

• Cat.No.: RGS2-190H
• Product Overview: Recombinant human RGS2 (211 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: T7
• Protein Length: 211 a.a.
• Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGEFGSMQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKP KTGKKSKQQAFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKAR KIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEP HAT
• Purity: >90% by SDS-PAGE.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.

Gene Information

• Gene Name: RGS2 regulator of G-protein signaling 2, 24kDa [ Homo sapiens ]
• Official Symbol: RGS2
• Synonyms: RGS2; regulator of G-protein signaling 2, 24kDa; G0S8, regulator of G protein signalling 2, 24kD , regulator of G protein signalling 2, 24kDa; G0S8
• Gene ID: 5997
• mRNA Refseq: NM_002923
• Protein Refseq: NP_002914
• MIM: 600861
• UniProt ID: P41220
• Chromosome Location: 1q31
• Pathway: Calcium Regulation in the Cardiac Cell, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by GPCR, organism-specific biosystem
• Function: GTPase activator activity; calmodulin binding; protein binding