"RGS2" Related Products

Expand
Expand

Recombinant Human RGS2 protein, T7-tagged

Cat.No.: RGS2-190H
Product Overview: Recombinant human RGS2 (211 aa) protein fused with T7 Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7
Form: 0.2 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGEFGSMQSAMFLAVQHDCRPMDKSAGSGHKSEEKREKMKRTLLKDWKTRLSYFLQNSSTPGKP KTGKKSKQQAFIKPSPEEAQLWSEAFDELLASKYGLAAFRAFLKSEFCEENIEFWLACEDFKKTKSPQKLSSKAR KIYTDFIEKEAPKEINIDFQTKTLIAQNIQEATSGCFTTAQKRVYSLMENNSYPRFLESEFYQDLCKKPQITTEP HAT
Purity: >90% by SDS-PAGE.
Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days.
Gene Name: RGS2 regulator of G-protein signaling 2, 24kDa [ Homo sapiens ]
Official Symbol: RGS2
Synonyms: RGS2; regulator of G-protein signaling 2, 24kDa; G0S8, regulator of G protein signalling 2, 24kD , regulator of G protein signalling 2, 24kDa; G0S8;
Gene ID: 5997
mRNA Refseq: NM_002923
Protein Refseq: NP_002914
MIM: 600861
UniProt ID: P41220
Chromosome Location: 1q31
Pathway: Calcium Regulation in the Cardiac Cell, organism-specific biosystem; G alpha (q) signalling events, organism-specific biosystem; GPCR downstream signaling, organism-specific biosystem; Myometrial Relaxation and Contraction Pathways, organism-specific biosystem; Signal Transduction, organism-specific biosystem; Signaling by GPCR, organism-specific biosystem;
Function: GTPase activator activity; calmodulin binding; protein binding;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.