Recombinant Human RNF145 Protein, GST-tagged
Cat.No. : | RNF145-4301H |
Product Overview : | Human FLJ31951 partial ORF ( NP_653327, 592 a.a. - 691 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | RNF145 (Ring Finger Protein 145) is a Protein Coding gene. An important paralog of this gene is RNF139. |
Molecular Mass : | 36.74 kDa |
AA Sequence : | WLYVQETCPLCHCHLKNSSQLPGLGTEPVLQPHAGAEQNVMFQEGTEPPGQEHTPGTRIQEGSRDNNEYIARRPDNQEGAFDPKEYPHSAKDEAHPVESA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | RNF145 ring finger protein 145 [ Homo sapiens ] |
Official Symbol | RNF145 |
Synonyms | RNF145; ring finger protein 145; FLJ31951; |
Gene ID | 153830 |
mRNA Refseq | NM_001199380 |
Protein Refseq | NP_001186309 |
UniProt ID | Q96MT1 |
◆ Recombinant Proteins | ||
RNF145-4301H | Recombinant Human RNF145 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RNF145 Products
Required fields are marked with *
My Review for All RNF145 Products
Required fields are marked with *