Recombinant Human RNF145 Protein, GST-tagged

Cat.No. : RNF145-4301H
Product Overview : Human FLJ31951 partial ORF ( NP_653327, 592 a.a. - 691 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : RNF145 (Ring Finger Protein 145) is a Protein Coding gene. An important paralog of this gene is RNF139.
Molecular Mass : 36.74 kDa
AA Sequence : WLYVQETCPLCHCHLKNSSQLPGLGTEPVLQPHAGAEQNVMFQEGTEPPGQEHTPGTRIQEGSRDNNEYIARRPDNQEGAFDPKEYPHSAKDEAHPVESA
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RNF145 ring finger protein 145 [ Homo sapiens ]
Official Symbol RNF145
Synonyms RNF145; ring finger protein 145; FLJ31951;
Gene ID 153830
mRNA Refseq NM_001199380
Protein Refseq NP_001186309
UniProt ID Q96MT1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RNF145 Products

Required fields are marked with *

My Review for All RNF145 Products

Required fields are marked with *

0
cart-icon