Recombinant Human ROM1 protein, His-tagged
| Cat.No. : | ROM1-3542H |
| Product Overview : | Recombinant Human ROM1 protein(121-270 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | February 05, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 121-270 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
| AASequence : | LALALPGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGTLGS |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | ROM1 retinal outer segment membrane protein 1 [ Homo sapiens ] |
| Official Symbol | ROM1 |
| Synonyms | ROM1; retinal outer segment membrane protein 1; rod outer segment membrane protein 1; ROM; TSPAN23; tspan-23; tetraspanin-23; RP7; ROSP1; |
| Gene ID | 6094 |
| mRNA Refseq | NM_000327 |
| Protein Refseq | NP_000318 |
| MIM | 180721 |
| UniProt ID | Q03395 |
| ◆ Recombinant Proteins | ||
| ROM1-3542H | Recombinant Human ROM1 protein, His-tagged | +Inquiry |
| ROM1-5096R | Recombinant Rat ROM1 Protein | +Inquiry |
| Rom1-1666M | Recombinant Mouse Rom1 protein, His & T7-tagged | +Inquiry |
| ROM1-7702M | Recombinant Mouse ROM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RFL10994BF | Recombinant Full Length Bovine Rod Outer Segment Membrane Protein 1(Rom1) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| ROM1-2253HCL | Recombinant Human ROM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ROM1 Products
Required fields are marked with *
My Review for All ROM1 Products
Required fields are marked with *
