Recombinant Human ROM1 protein, His-tagged
Cat.No. : | ROM1-3542H |
Product Overview : | Recombinant Human ROM1 protein(121-270 aa), fused to His tag, was expressed in E. coli. |
Availability | April 30, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 121-270 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | LALALPGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGTLGS |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | ROM1 retinal outer segment membrane protein 1 [ Homo sapiens ] |
Official Symbol | ROM1 |
Synonyms | ROM1; retinal outer segment membrane protein 1; rod outer segment membrane protein 1; ROM; TSPAN23; tspan-23; tetraspanin-23; RP7; ROSP1; |
Gene ID | 6094 |
mRNA Refseq | NM_000327 |
Protein Refseq | NP_000318 |
MIM | 180721 |
UniProt ID | Q03395 |
◆ Recombinant Proteins | ||
RFL32965MF | Recombinant Full Length Mouse Rod Outer Segment Membrane Protein 1(Rom1) Protein, His-Tagged | +Inquiry |
ROM1-7702M | Recombinant Mouse ROM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ROM1-4755R | Recombinant Rat ROM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ROM1-617H | Recombinant Human ROM1 Protein, His-tagged | +Inquiry |
ROM1-5096R | Recombinant Rat ROM1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
ROM1-2253HCL | Recombinant Human ROM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All ROM1 Products
Required fields are marked with *
My Review for All ROM1 Products
Required fields are marked with *
0
Inquiry Basket