Recombinant Human ROM1 protein, His-tagged
Cat.No. : | ROM1-3542H |
Product Overview : | Recombinant Human ROM1 protein(121-270 aa), fused with N-terminal His tag, was expressed in E.coli. |
Availability | October 11, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 121-270 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | LALALPGSLDEALEEGLVTALAHYKDTEVPGHCQAKRLVDELQLRYHCCGRHGYKDWFGVQWVSSRYLDPGDRDVADRIQSNVEGLYLTDGVPFSCCNPHSPRPCLQNRLSDSYAHPLFDPRQPNQNLWAQGCHEVLLEHLQDLAGTLGS |
Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
Gene Name | ROM1 retinal outer segment membrane protein 1 [ Homo sapiens ] |
Official Symbol | ROM1 |
Synonyms | ROM1; retinal outer segment membrane protein 1; rod outer segment membrane protein 1; ROM; TSPAN23; tspan-23; tetraspanin-23; RP7; ROSP1; |
Gene ID | 6094 |
mRNA Refseq | NM_000327 |
Protein Refseq | NP_000318 |
MIM | 180721 |
UniProt ID | Q03395 |
◆ Recombinant Proteins | ||
ROM1-5096R | Recombinant Rat ROM1 Protein | +Inquiry |
ROM1-30954TH | Recombinant Human ROM1 | +Inquiry |
RFL10994BF | Recombinant Full Length Bovine Rod Outer Segment Membrane Protein 1(Rom1) Protein, His-Tagged | +Inquiry |
ROM1-7702M | Recombinant Mouse ROM1 Protein, His (Fc)-Avi-tagged | +Inquiry |
ROM1-617H | Recombinant Human ROM1 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ROM1-2253HCL | Recombinant Human ROM1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ROM1 Products
Required fields are marked with *
My Review for All ROM1 Products
Required fields are marked with *