Recombinant Human RPA3 protein, His-tagged
| Cat.No. : | RPA3-3441H |
| Product Overview : | Recombinant Human RPA3 protein(P35244)(1-119aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-119aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 17.3 kDa |
| AA Sequence : | MVDMMDLPRSRINAGMLAQFIDKPVCFVGRLEKIHPTGKMFILSDGEGKNGTIELMEPLDEEISGIVEVVGRVTAKATILCTSYVQFKEDSHPFDLGLYNEAVKIIHDFPQFYPLGIVQ |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | RPA3 replication protein A3, 14kDa [ Homo sapiens ] |
| Official Symbol | RPA3 |
| Synonyms | RPA3; replication protein A3, 14kDa; replication protein A3 (14kD); replication protein A 14 kDa subunit; REPA3; RP-A p14; RF-A protein 3; replication factor A protein 3; |
| Gene ID | 6119 |
| mRNA Refseq | NM_002947 |
| Protein Refseq | NP_002938 |
| MIM | 179837 |
| UniProt ID | P35244 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPA3 Products
Required fields are marked with *
My Review for All RPA3 Products
Required fields are marked with *




