Recombinant Human RPGRIP1L protein, GST-tagged
| Cat.No. : | RPGRIP1L-7434H |
| Product Overview : | Recombinant Human RPGRIP1L protein(1-140 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-140 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 100 mM reduced glutathione (GSH). |
| AASequence : | MSGPTDETAGDLPVKDTGLNLFGMGGLQETSTTRTMKSRQAVSRVSREELEDRFLRLHDENILLKQHARKQEDKIKRMATKLIRLVNDKKRYERVGGGPKRLGRDVEMEEMIEQLQEKVHELEKQNETLKNRLISAKQQL |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | RPGRIP1L RPGRIP1-like [ Homo sapiens ] |
| Official Symbol | RPGRIP1L |
| Synonyms | RPGRIP1L; RPGRIP1-like; protein fantom; CORS3; fantom homolog; FTM; JBTS7; KIAA1005; Meckel syndrome; type 5; MKS5; NPHP8; nephrocystin 8; nephrocystin-8; RPGRIP1-like protein; RPGR-interacting protein 1-like protein; DKFZp686C0668; |
| Gene ID | 23322 |
| mRNA Refseq | NM_001127897 |
| Protein Refseq | NP_001121369 |
| MIM | 610937 |
| UniProt ID | Q68CZ1 |
| ◆ Recombinant Proteins | ||
| RPGRIP1L-7433H | Recombinant Human RPGRIP1L protein, His-tagged | +Inquiry |
| RPGRIP1L-14399M | Recombinant Mouse RPGRIP1L Protein | +Inquiry |
| RPGRIP1L-7716M | Recombinant Mouse RPGRIP1L Protein, His (Fc)-Avi-tagged | +Inquiry |
| RPGRIP1L-8097Z | Recombinant Zebrafish RPGRIP1L | +Inquiry |
| RPGRIP1L-3784R | Recombinant Rhesus Macaque RPGRIP1L Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPGRIP1L Products
Required fields are marked with *
My Review for All RPGRIP1L Products
Required fields are marked with *
