Recombinant Human RPP38 protein(41-120 aa), C-His-tagged

Cat.No. : RPP38-2807H
Product Overview : Recombinant Human RPP38 protein(P78345)(41-120 aa), fused with C-terminal His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 41-120 aa
Form : 0.15 M Phosphate buffered saline
Storage : Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing.
Up to 12 months when aliquoted and stored at -20 to -80°C.
Reconstitution : It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents.
AA Sequence : MHFILQTLEDRLKAIGLQKIEDKKKKNKTPFLKKESREKCSIAVDISENLKEKKTDAKQQVSGWTPAHVRKQLAIGVNEV
Gene Name RPP38 ribonuclease P/MRP 38kDa subunit [ Homo sapiens ]
Official Symbol RPP38
Synonyms RPP38; ribonuclease P/MRP 38kDa subunit; ribonuclease P protein subunit p38; RNaseP protein p38; ribonuclease P (38kD) (RPP38); RP11-455B2.5;
Gene ID 10557
mRNA Refseq NM_001097590
Protein Refseq NP_001091059
MIM 606116
UniProt ID P78345

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RPP38 Products

Required fields are marked with *

My Review for All RPP38 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon