Recombinant Human RPP38 protein(41-120 aa), C-His-tagged
Cat.No. : | RPP38-2807H |
Product Overview : | Recombinant Human RPP38 protein(P78345)(41-120 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 41-120 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | MHFILQTLEDRLKAIGLQKIEDKKKKNKTPFLKKESREKCSIAVDISENLKEKKTDAKQQVSGWTPAHVRKQLAIGVNEV |
Gene Name | RPP38 ribonuclease P/MRP 38kDa subunit [ Homo sapiens ] |
Official Symbol | RPP38 |
Synonyms | RPP38; ribonuclease P/MRP 38kDa subunit; ribonuclease P protein subunit p38; RNaseP protein p38; ribonuclease P (38kD) (RPP38); RP11-455B2.5; |
Gene ID | 10557 |
mRNA Refseq | NM_001097590 |
Protein Refseq | NP_001091059 |
MIM | 606116 |
UniProt ID | P78345 |
◆ Recombinant Proteins | ||
RPP38-4406C | Recombinant Chicken RPP38 | +Inquiry |
RPP38-01H | Recombinant Human RPP38 Protein, GST-tagged | +Inquiry |
RPP38-2807H | Recombinant Human RPP38 protein(41-120 aa), C-His-tagged | +Inquiry |
RPP38-649Z | Recombinant Zebrafish RPP38 | +Inquiry |
◆ Cell & Tissue Lysates | ||
RPP38-555HCL | Recombinant Human RPP38 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RPP38 Products
Required fields are marked with *
My Review for All RPP38 Products
Required fields are marked with *
0
Inquiry Basket