Recombinant Human RPS19BP1 protein, His-tagged
Cat.No. : | RPS19BP1-2421H |
Product Overview : | Recombinant Human RPS19BP1 protein(1-136 aa), fused with N-terminal His tag, was expressed in E. coli. |
Availability | October 10, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 1-136 aa |
Tag : | N-His |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
Purity : | 95%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
AA Sequence : | MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS |
Gene Name | RPS19BP1 ribosomal protein S19 binding protein 1 [ Homo sapiens ] |
Official Symbol | RPS19BP1 |
Synonyms | RPS19BP1; ribosomal protein S19 binding protein 1; active regulator of SIRT1; FLJ21770; MGC52010; RPS19-binding protein 1; homolog of mouse S19 binding protein; 40S ribosomal protein S19-binding protein 1; AROS; S19BP; dJ1104E15.4; |
Gene ID | 91582 |
mRNA Refseq | NM_194326 |
Protein Refseq | NP_919307 |
MIM | 610225 |
UniProt ID | Q86WX3 |
◆ Recombinant Proteins | ||
ABCE1-0260H | Recombinant Human ABCE1 Protein (Ile389-Asn556), N-His-tagged | +Inquiry |
ABCE1-3392H | Recombinant Human ABCE1 protein, His-tagged | +Inquiry |
RPS19BP1-2421H | Recombinant Human RPS19BP1 protein, His-tagged | +Inquiry |
ABCE1-12286Z | Recombinant Zebrafish ABCE1 | +Inquiry |
ABCE1-5743H | Recombinant Human ABCE1 protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
ABCE1-9145HCL | Recombinant Human ABCE1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All ABCE1 Products
Required fields are marked with *
My Review for All ABCE1 Products
Required fields are marked with *