Recombinant Human RPS19BP1 protein, His-tagged

Cat.No. : RPS19BP1-2421H
Product Overview : Recombinant Human RPS19BP1 protein(1-136 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability February 03, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-136 aa
Tag : N-His
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Purity : 95%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
AA Sequence : MSAALLRRGLELLAASEAPRDPPGQAKPRGAPVKRPRKTKAIQAQKLRNSAKGKVPKSALDEYRKRECRDHLRVNLKFLTRTRSTVAESVSQQILRQNRGRKACDRPVAKTKKKKAEGTVFTEEDFQKFQQEYFGS
Gene Name RPS19BP1 ribosomal protein S19 binding protein 1 [ Homo sapiens ]
Official Symbol RPS19BP1
Synonyms RPS19BP1; ribosomal protein S19 binding protein 1; active regulator of SIRT1; FLJ21770; MGC52010; RPS19-binding protein 1; homolog of mouse S19 binding protein; 40S ribosomal protein S19-binding protein 1; AROS; S19BP; dJ1104E15.4;
Gene ID 91582
mRNA Refseq NM_194326
Protein Refseq NP_919307
MIM 610225
UniProt ID Q86WX3

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All ABCE1 Products

Required fields are marked with *

My Review for All ABCE1 Products

Required fields are marked with *

0
cart-icon
0
compare icon