Recombinant Human RSF1 Protein, GST-tagged
| Cat.No. : | RSF1-4610H |
| Product Overview : | Human HBXAP partial ORF ( NP_057662.3, 1343 a.a. - 1441 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | HBXAP is involved in transcription repression, transcription coactivation when associated with hepatitis B virus X protein (HBX), and chromatin remodeling and spacing when associated with SNF2H (MIM 603375).[supplied by OMIM |
| Molecular Mass : | 36.63 kDa |
| AA Sequence : | IESDEEEDFENVGKVGSPLDYSLVDLPSTNGQSPGKAIENLIGKPTEKSQTPKDNSTASASLASNGTSGGQEAGAPEEEEDELLRVTDLVDYVCNSEQL |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -8 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | RSF1 remodeling and spacing factor 1 [ Homo sapiens ] |
| Official Symbol | RSF1 |
| Synonyms | RSF1; remodeling and spacing factor 1; HBXAP, hepatitis B virus x associated protein; p325; RSF 1; XAP8; HBV pX associated protein-8; HBV pX-associated protein 8; hepatitis B virus x associated protein; hepatitis B virus x-associated protein; p325 subunit of RSF chromatin-remodeling complex; HBXAP; RSF-1; |
| Gene ID | 51773 |
| mRNA Refseq | NM_016578 |
| Protein Refseq | NP_057662 |
| MIM | 608522 |
| UniProt ID | Q96T23 |
| ◆ Recombinant Proteins | ||
| RSF1-4610H | Recombinant Human RSF1 Protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RSF1 Products
Required fields are marked with *
My Review for All RSF1 Products
Required fields are marked with *
