Recombinant Human RSPH1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | RSPH1-5352H |
| Product Overview : | RSPH1 MS Standard C13 and N15-labeled recombinant protein (NP_543136) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | This gene encodes a male meiotic metaphase chromosome-associated acidic protein. This gene is expressed in tissues with motile cilia or flagella, including the trachea, lungs, airway brushings, and testes. Mutations in this gene result in primary ciliary dyskinesia-24. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. |
| Molecular Mass : | 35.1 kDa |
| AA Sequence : | MSDLGSEELEEEGENDIGEYEGGRNEAGERHGRGRARLPNGDTYEGSYEFGKRHGQGIYKFKNGARYIGEYVRNKKHGQGTFIYPDGSRYEGEWANDLRHGHGVYYYINNDTYTGEWFAHQRHGQGTYLYAETGSKYVGTWVNGQQEGTAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTLPKKPTSTDGPGQDAPGAESAGEPGEEAQALLEGFEGEMDMRPGDEDADVLREESREYDQEEFRYDMDEGNINSEEEETRQSDLQDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | RSPH1 radial spoke head component 1 [ Homo sapiens (human) ] |
| Official Symbol | RSPH1 |
| Synonyms | RSPH1; radial spoke head 1 homolog (Chlamydomonas); testis specific A2 homolog (mouse), TSGA2; radial spoke head 1 homolog; FLJ32753; meichroacidin; RSP44; RSPH10A; CT79; h-meichroacidin; cancer/testis antigen 79; testes specific A2 homolog; testis specific A2 homolog; testes specific gene A2 homolog; testis-specific gene A2 protein; male meiotic metaphase chromosome-associated acidic protein; TSA2; TSGA2; MGC126568; MGC141927; |
| Gene ID | 89765 |
| mRNA Refseq | NM_080860 |
| Protein Refseq | NP_543136 |
| MIM | 609314 |
| UniProt ID | Q8WYR4 |
| ◆ Recombinant Proteins | ||
| RSPH1-4044R | Recombinant Rhesus monkey RSPH1 Protein, His-tagged | +Inquiry |
| RSPH1-3861R | Recombinant Rhesus Macaque RSPH1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| RSPH1-5352H | Recombinant Human RSPH1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Rsph1-5634M | Recombinant Mouse Rsph1 Protein, Myc/DDK-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| RSPH1-2131HCL | Recombinant Human RSPH1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All RSPH1 Products
Required fields are marked with *
My Review for All RSPH1 Products
Required fields are marked with *
