Recombinant Human RSPH1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : RSPH1-5352H
Product Overview : RSPH1 MS Standard C13 and N15-labeled recombinant protein (NP_543136) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a male meiotic metaphase chromosome-associated acidic protein. This gene is expressed in tissues with motile cilia or flagella, including the trachea, lungs, airway brushings, and testes. Mutations in this gene result in primary ciliary dyskinesia-24. Alternatively spliced transcript variants encoding different isoforms have been found for this gene.
Molecular Mass : 35.1 kDa
AA Sequence : MSDLGSEELEEEGENDIGEYEGGRNEAGERHGRGRARLPNGDTYEGSYEFGKRHGQGIYKFKNGARYIGEYVRNKKHGQGTFIYPDGSRYEGEWANDLRHGHGVYYYINNDTYTGEWFAHQRHGQGTYLYAETGSKYVGTWVNGQQEGTAELIHLNHRYQGKFLNKNPVGPGKYVFDVGCEQHGEYRLTDMERGEEEEEEELVTVVPKWKATQITELALWTPTLPKKPTSTDGPGQDAPGAESAGEPGEEAQALLEGFEGEMDMRPGDEDADVLREESREYDQEEFRYDMDEGNINSEEEETRQSDLQDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name RSPH1 radial spoke head component 1 [ Homo sapiens (human) ]
Official Symbol RSPH1
Synonyms RSPH1; radial spoke head 1 homolog (Chlamydomonas); testis specific A2 homolog (mouse), TSGA2; radial spoke head 1 homolog; FLJ32753; meichroacidin; RSP44; RSPH10A; CT79; h-meichroacidin; cancer/testis antigen 79; testes specific A2 homolog; testis specific A2 homolog; testes specific gene A2 homolog; testis-specific gene A2 protein; male meiotic metaphase chromosome-associated acidic protein; TSA2; TSGA2; MGC126568; MGC141927;
Gene ID 89765
mRNA Refseq NM_080860
Protein Refseq NP_543136
MIM 609314
UniProt ID Q8WYR4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RSPH1 Products

Required fields are marked with *

My Review for All RSPH1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon