Recombinant Human RSPH9 Protein, GST-Tagged

Cat.No. : RSPH9-0117H
Product Overview : Human C6orf206 full-length ORF (NP_689945.2, 1 a.a. - 276 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a protein thought to be a component of the radial spoke head in motile cilia and flagella. Mutations in this gene are associated with primary ciliary dyskinesia 12. Alternative splicing results in multiple transcript variants.[provided by RefSeq, Jul 2010]
Molecular Mass : 57.7 kDa
AA Sequence : MDADSLLLSLELASGSGQGLSPDRRASLLTSLMLVKRDYRYDRVLFWGRILGLVADYYIAQGLSEDQLAPRKTLYSLNCTEWSLLPPATEEMVAQSSVVKGRFMGDPSYEYEHTELQKVNEGEKVFEEEIVVQIKEETRLVSVIDQIDKAVAIIPRGALFKTPFGPTHVNRTFEGLSLSEAKKLSSYFHFREPVELKNKTLLEKADLDPSLDFMDSLEHDIPKGSWSIQMERGNALVVLRSLLWPGLTFYHAPRTKNYGYVYVGTGEKNMDLPFML
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name RSPH9 radial spoke head 9 homolog (Chlamydomonas) [ Homo sapiens ]
Official Symbol RSPH9
Synonyms RSPH9; radial spoke head 9 homolog (Chlamydomonas); C6orf206, chromosome 6 open reading frame 206, mitochondrial ribosomal protein S18A like 1, MRPS18AL1; radial spoke head protein 9 homolog; CILD12; FLJ30845; C6orf206; MRPS18AL1;
Gene ID 221421
mRNA Refseq NM_001193341
Protein Refseq NP_001180270
MIM 612648
UniProt ID Q9H1X1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All RSPH9 Products

Required fields are marked with *

My Review for All RSPH9 Products

Required fields are marked with *

0
cart-icon
0
compare icon