Recombinant Human S100A7A Protein (2-101 aa), His-tagged

• Cat.No.: S100A7A-1686H
• Product Overview: Recombinant Human S100A7A Protein (2-101 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial.

Specification

• Species: Human
• Source: Yeast
• Tag: His
• Protein Length: 2-101 aa
• Description: May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases.
• Form: Tris-based buffer,50% glycerol
• Molecular Mass: 13.2 kDa
• AA Sequence: SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ
• Purity: > 90% as determined by SDS-PAGE.
• Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week.
• Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade.
• Concentration: A hardcopy of COA with reconstitution instruction is sent along with the products.

Gene Information

• Gene Name: S100A7A S100 calcium binding protein A7A [ Homo sapiens ]
• Official Symbol: S100A7A
• Synonyms: S100A7A; protein S100-A7A; S100A7f; NICE-2; S100A15; S100A7L1
• Gene ID: 338324
• mRNA Refseq: NM_176823
• Protein Refseq: NP_789793
• UniProt ID: Q86SG5