Recombinant Human S100A7A Protein (2-101 aa), His-tagged
| Cat.No. : | S100A7A-1686H |
| Product Overview : | Recombinant Human S100A7A Protein (2-101 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Research Area: Cell Biology. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Yeast |
| Tag : | His |
| Protein Length : | 2-101 aa |
| Description : | May be involved in epidermal differentiation and inflammation and might therefore be important for the pathogenesis of psoriasis and other diseases. |
| Form : | Tris-based buffer,50% glycerol |
| Molecular Mass : | 13.2 kDa |
| AA Sequence : | SNTQAERSIIGMIDMFHKYTGRDGKIEKPSLLTMMKENFPNFLSACDKKGIHYLATVFEKKDKNEDKKIDFSEFLSLLGDIAADYHKQSHGAAPCSGGSQ |
| Purity : | > 90% as determined by SDS-PAGE. |
| Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
| Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
| Concentration : | A hardcopy of COA with reconstitution instruction is sent along with the products. |
| Gene Name | S100A7A S100 calcium binding protein A7A [ Homo sapiens ] |
| Official Symbol | S100A7A |
| Synonyms | S100A7A; protein S100-A7A; S100A7f; NICE-2; S100A15; S100A7L1; |
| Gene ID | 338324 |
| mRNA Refseq | NM_176823 |
| Protein Refseq | NP_789793 |
| UniProt ID | Q86SG5 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100A7A Products
Required fields are marked with *
My Review for All S100A7A Products
Required fields are marked with *
