Recombinant Human S100P Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : S100P-3900H
Product Overview : S100P MS Standard C13 and N15-labeled recombinant protein (NP_005971) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer.
Molecular Mass : 10.4 kDa
AA Sequence : MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name S100P S100 calcium binding protein P [ Homo sapiens (human) ]
Official Symbol S100P
Synonyms S100P; S100 calcium binding protein P; protein S100-P; protein S100-E; migration-inducing gene 9; S100 calcium-binding protein P; MIG9;
Gene ID 6286
mRNA Refseq NM_005980
Protein Refseq NP_005971
MIM 600614
UniProt ID P25815

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All S100P Products

Required fields are marked with *

My Review for All S100P Products

Required fields are marked with *

0
cart-icon