Recombinant Human S100P Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | S100P-3900H |
Product Overview : | S100P MS Standard C13 and N15-labeled recombinant protein (NP_005971) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 4p16. This protein, in addition to binding Ca2+, also binds Zn2+ and Mg2+. This protein may play a role in the etiology of prostate cancer. |
Molecular Mass : | 10.4 kDa |
AA Sequence : | MTELETAMGMIIDVFSRYSGSEGSTQTLTKGELKVLMEKELPGFLQSGKDKDAVDKLLKDLDANGDAQVDFSEFIVFVAAITSACHKYFEKAGLKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | S100P S100 calcium binding protein P [ Homo sapiens (human) ] |
Official Symbol | S100P |
Synonyms | S100P; S100 calcium binding protein P; protein S100-P; protein S100-E; migration-inducing gene 9; S100 calcium-binding protein P; MIG9; |
Gene ID | 6286 |
mRNA Refseq | NM_005980 |
Protein Refseq | NP_005971 |
MIM | 600614 |
UniProt ID | P25815 |
◆ Recombinant Proteins | ||
S100P-3900H | Recombinant Human S100P Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
S100P-3983H | Recombinant Human S100P protein | +Inquiry |
S100P-2482H | Recombinant Human S100 Calcium Binding Protein P, His-tagged | +Inquiry |
S100P-387HFL | Recombinant Full Length Human S100P Protein, C-Flag-tagged | +Inquiry |
S100P-2495H | Recombinant Human S100P, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
S100P-2086HCL | Recombinant Human S100P 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All S100P Products
Required fields are marked with *
My Review for All S100P Products
Required fields are marked with *