Recombinant Human SCGB2A1 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SCGB2A1-949H |
| Product Overview : | SCGB2A1 MS Standard C13 and N15-labeled recombinant protein (NP_002398) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | May bind androgens and other steroids, may also bind estramustine, a chemotherapeutic agent used for prostate cancer. May be under transcriptional regulation of steroid hormones. |
| Molecular Mass : | 10.9 kDa |
| AA Sequence : | MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSNTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SCGB2A1 secretoglobin family 2A member 1 [ Homo sapiens (human) ] |
| Official Symbol | SCGB2A1 |
| Synonyms | SCGB2A1; secretoglobin, family 2A, member 1; mammaglobin 2, MGB2; mammaglobin-B; lacryglobin; lipophilin C; LPHC; mammaglobin B; MGC71973; UGB3; lipophilin-C; mammaglobin 2; mammaglobin-2; MGB2; |
| Gene ID | 4246 |
| mRNA Refseq | NM_002407 |
| Protein Refseq | NP_002398 |
| MIM | 604398 |
| UniProt ID | O75556 |
| ◆ Recombinant Proteins | ||
| SCGB2A1-29236TH | Recombinant Full Length Human SCGB2A1 Protein, GST-tagged | +Inquiry |
| SCGB2A1-950H | Recombinant Human SCGB2A1 Protein, Myc/DDK-tagged | +Inquiry |
| SCGB2A1-2529H | Recombinant Human SCGB2A1, GST-tagged | +Inquiry |
| SCGB2A1-680H | Recombinant Full Length Human SCGB2A1 protein(Met1-Asn95), hFc-tagged | +Inquiry |
| SCGB2A1-1963H | Recombinant Human SCGB2A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SCGB2A1-2037HCL | Recombinant Human SCGB2A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCGB2A1 Products
Required fields are marked with *
My Review for All SCGB2A1 Products
Required fields are marked with *
