Recombinant Full Length Human SCGB2A1 Protein, GST-tagged
Cat.No. : | SCGB2A1-29236TH |
Product Overview : | Recombinant full length Human Mammaglobin B with an N-terminal proprietary tag; Predicted MW 36.52 kDa |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 1-95 a.a. |
Molecular Weight : | 36.520kDa |
Tissue specificity : | Expressed in thymus, trachea, kidney, steroid responsive tissues (prostate, testis, uterus, breast and ovary) and salivary gland. |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | MKLLMVLMLAALLLHCYADSGCKLLEDMVEKTINSDISIPEYKELLQEFIDSDAAAEAMGKFKQCFLNQSHRTLKNFGLMMHTVYDSIWCNMKSN |
Sequence Similarities : | Belongs to the secretoglobin family. Lipophilin subfamily. |
Gene Name | SCGB2A1 secretoglobin, family 2A, member 1 [ Homo sapiens ] |
Official Symbol | SCGB2A1 |
Synonyms | SCGB2A1; secretoglobin, family 2A, member 1; mammaglobin 2 , MGB2; mammaglobin-B; lacryglobin; lipophilin C; LPHC; mammaglobin B; MGC71973; UGB3; |
Gene ID | 4246 |
mRNA Refseq | NM_002407 |
Protein Refseq | NP_002398 |
MIM | 604398 |
Uniprot ID | O75556 |
Chromosome Location | 11q13 |
Function | androgen binding; binding; |
◆ Recombinant Proteins | ||
SCGB2A1-29236TH | Recombinant Full Length Human SCGB2A1 Protein, GST-tagged | +Inquiry |
SCGB2A1-1262HFL | Recombinant Full Length Human SCGB2A1 Protein, C-Flag-tagged | +Inquiry |
SCGB2A1-950H | Recombinant Human SCGB2A1 Protein, Myc/DDK-tagged | +Inquiry |
SCGB2A1-250H | Recombinant Human SCGB2A1 Protein, MBP/His-tagged | +Inquiry |
SCGB2A1-2239H | Recombinant Human SCGB2A1 protein(19-95aa), His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SCGB2A1-2037HCL | Recombinant Human SCGB2A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SCGB2A1 Products
Required fields are marked with *
My Review for All SCGB2A1 Products
Required fields are marked with *
0
Inquiry Basket