"SCML1" Related Products

Recombinant Human SCML1 protein, T7/His-tagged

Cat.No.: SCML1-215H
Product Overview: Recombinant human SCML1 cDNA (2 – 302aa, Isoform-B, which derived from BC026159) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGEFMSNSSSEIDVQEPNIVSDASCNTEEQLKTVDDVLIHCQVIYDALQNL DKKIDVIRRKVSKIQRFHARSLWTNHKRYGYKKHSYRLVKKLKLQKMKKNEVYETFSYPESYSPTLPVSRRENNS PSNLPRPSFCMEEYQRAELEEDPILSRTPSPVHPSDFSEHNCQPYYASDGATYGSSSGLCLGNPRADSIHNTYST DHASAAPPSVTRSPVENDGYIEEGSITKHPSTWSVEAVVLFLKQTDPLALCPLVDLFRSHEIDGKALLLLTSDVL LKHLGVKLGTAVKLCYYIDRLKQGKCFEN
Purity: >90% by SDS-PAGE
Storage: Keep at -80 centigrade for long term storage. Product is stable at 4 centigrade for at least 7 days.
Gene Name: SCML1 sex comb on midleg-like 1 (Drosophila) [ Homo sapiens ]
Official Symbol: SCML1
Synonyms: SCML1; sex comb on midleg-like 1 (Drosophila); sex comb on midleg (Drosophila) like 1; sex comb on midleg-like protein 1;
Gene ID: 6322
mRNA Refseq: NM_001037535
Protein Refseq: NP_001032624
MIM: 300227
UniProt ID: Q9UN30
Chromosome Location: Xp22
Function: DNA binding; sequence-specific DNA binding transcription factor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.