Recombinant Human SDHD

• Cat.No.: SDHD-31390TH
• Product Overview: Recombinant full length Human SDHD with a N terminal proprietary tag: predicted MW 43.56 kDa.

Specification

• Species: Human
• Source: Wheat Germ
• Tag: Non
• Protein Length: 159 amino acids
• Description: Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ.The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane.The subunit D protein is one of two integral membrane proteins anchoring the complex to the matrix side of the membrane.Mutations in SDHD have been linked to hereditary paraganglioma.
• Molecular Weight: 43.560kDa inclusive of tags
• Form: Liquid
• Purity: Proprietary Purification
• Storage buffer: pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
• Storage: Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
• Sequences of amino acids: MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPI PEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLGLL PAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDAL QKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL
• Sequence Similarities: Belongs to the CybS family.

Gene Information

• Gene Name: SDHD succinate dehydrogenase complex, subunit D, integral membrane protein [ Homo sapiens ]
• Official Symbol: SDHD
• Synonyms: SDHD; succinate dehydrogenase complex, subunit D, integral membrane protein; PGL, PGL1; succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
• Gene ID: 6392
• mRNA Refseq: NM_003002
• Protein Refseq: NP_002993
• MIM: 602690
• Uniprot ID: O14521
• Chromosome Location: 11q23
• Pathway: Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, second carbon oxidation, 2-oxoglutarate =>
• Function: electron carrier activity; heme binding; metal ion binding; succinate dehydrogenase activity; ubiquinone binding