Recombinant Human SDHD

Cat.No. : SDHD-31390TH
Product Overview : Recombinant full length Human SDHD with a N terminal proprietary tag: predicted MW 43.56 kDa.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : Non
Protein Length : 159 amino acids
Description : Complex II of the respiratory chain, which is specifically involved in the oxidation of succinate, carries electrons from FADH to CoQ.The complex is composed of four nuclear-encoded subunits and is localized in the mitochondrial inner membrane.The subunit D protein is one of two integral membrane proteins anchoring the complex to the matrix side of the membrane.Mutations in SDHD have been linked to hereditary paraganglioma.
Molecular Weight : 43.560kDa inclusive of tags
Form : Liquid
Purity : Proprietary Purification
Storage buffer : pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl
Storage : Shipped at 4°C. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles.
Sequences of amino acids : MAVLWRLSAVCGALGGRALLLRTPVVRPAHISAFLQDRPI PEWCGVQHIHLSPSHHSGSKAASLHWTSERVVSVLLLGLL PAAYLNPCSAMDYSLAAALTLHGHWGLGQVVTDYVHGDAL QKAAKAGLLALSALTFAGLCYFNYHDVGICKAVAMLWKL
Sequence Similarities : Belongs to the CybS family.
Gene Name SDHD succinate dehydrogenase complex, subunit D, integral membrane protein [ Homo sapiens ]
Official Symbol SDHD
Synonyms SDHD; succinate dehydrogenase complex, subunit D, integral membrane protein; PGL, PGL1; succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial;
Gene ID 6392
mRNA Refseq NM_003002
Protein Refseq NP_002993
MIM 602690
Uniprot ID O14521
Chromosome Location 11q23
Pathway Alzheimers disease, organism-specific biosystem; Alzheimers disease, conserved biosystem; Citrate cycle (TCA cycle), organism-specific biosystem; Citrate cycle (TCA cycle), conserved biosystem; Citrate cycle, second carbon oxidation, 2-oxoglutarate =>
Function electron carrier activity; heme binding; metal ion binding; succinate dehydrogenase activity; ubiquinone binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SDHD Products

Required fields are marked with *

My Review for All SDHD Products

Required fields are marked with *

0
cart-icon
0
compare icon