Recombinant Human SEC22C protein, His-tagged
| Cat.No. : | SEC22C-3222H | 
| Product Overview : | Recombinant Human SEC22C protein(22-162 aa), fused to His tag, was expressed in E. coli. | 
| Availability | November 03, 2025 | 
| Unit | |
| Price | |
| Qty | 
- Specification
 - Gene Information
 - Related Products
 - Download
 
| Species : | Human | 
| Source : | E.coli | 
| Tag : | His | 
| Protein Length : | 22-162 aa | 
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. | 
| AA Sequence : | TDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSIHFSSFGDVACMAICSCQCPAAMAFCFLETLWWEFTASYDTTCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVAN | 
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. | 
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.  | 
                                
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.  | 
                                
| Gene Name | SEC22C SEC22 vesicle trafficking protein homolog C (S. cerevisiae) [ Homo sapiens ] | 
| Official Symbol | SEC22C | 
| Synonyms | SEC22C; SEC22 vesicle trafficking protein homolog C (S. cerevisiae); SEC22 vesicle trafficking protein like 3 (S. cerevisiae) , SEC22L3; vesicle-trafficking protein SEC22c; MGC5373; MGC13261; secretion deficient 22C; SEC22 vesicle trafficking protein-like 3; SEC22L3; DKFZp761F2321; | 
| Gene ID | 9117 | 
| mRNA Refseq | NM_001201572 | 
| Protein Refseq | NP_001188501 | 
| MIM | 604028 | 
| UniProt ID | Q9BRL7 | 
| ◆ Cell & Tissue Lysates | ||
| SEC22C-1995HCL | Recombinant Human SEC22C 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
 - Q&As (0)
 
Ask a Question for All SEC22C Products
Required fields are marked with *
My Review for All SEC22C Products
Required fields are marked with *
  
        
    
      
            