Recombinant Human SEC22C protein, His-tagged
Cat.No. : | SEC22C-3222H |
Product Overview : | Recombinant Human SEC22C protein(22-162 aa), fused to His tag, was expressed in E. coli. |
Availability | June 13, 2025 |
Unit | |
Price | |
Qty |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 22-162 aa |
Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole. |
AA Sequence : | TDFYHTQDFLEWRRRLKSLALRLAQYPGRGSAEGCDFSIHFSSFGDVACMAICSCQCPAAMAFCFLETLWWEFTASYDTTCIGLASRPYAFLEFDSIIQKVKWHFNYVSSSQMECSLEKIQEELKLQPPAVLTLEDTDVAN |
Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
Gene Name | SEC22C SEC22 vesicle trafficking protein homolog C (S. cerevisiae) [ Homo sapiens ] |
Official Symbol | SEC22C |
Synonyms | SEC22C; SEC22 vesicle trafficking protein homolog C (S. cerevisiae); SEC22 vesicle trafficking protein like 3 (S. cerevisiae) , SEC22L3; vesicle-trafficking protein SEC22c; MGC5373; MGC13261; secretion deficient 22C; SEC22 vesicle trafficking protein-like 3; SEC22L3; DKFZp761F2321; |
Gene ID | 9117 |
mRNA Refseq | NM_001201572 |
Protein Refseq | NP_001188501 |
MIM | 604028 |
UniProt ID | Q9BRL7 |
◆ Recombinant Proteins | ||
SEC22C-14828M | Recombinant Mouse SEC22C Protein | +Inquiry |
RFL14399BF | Recombinant Full Length Bovine Vesicle-Trafficking Protein Sec22C(Sec22C) Protein, His-Tagged | +Inquiry |
SEC22C-3941R | Recombinant Rhesus Macaque SEC22C Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL30542HF | Recombinant Full Length Human Vesicle-Trafficking Protein Sec22C(Sec22C) Protein, His-Tagged | +Inquiry |
SEC22C-3222H | Recombinant Human SEC22C protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SEC22C-1995HCL | Recombinant Human SEC22C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SEC22C Products
Required fields are marked with *
My Review for All SEC22C Products
Required fields are marked with *
0
Inquiry Basket