Recombinant Human SELENOP protein(181-290 aa), C-His-tagged
Cat.No. : | SELENOP-2778H |
Product Overview : | Recombinant Human SELENOP protein(P49908)(181-290 aa), fused with C-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 181-290 aa |
Form : | 0.15 M Phosphate buffered saline |
Storage : | Shipped on dry ice. Avoid repeated freeze-thaw cycles. Upon receipt, 2 days when stored at 2 to 8 °C after thawing. Up to 12 months when aliquoted and stored at -20 to -80°C. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.2 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
AA Sequence : | KDEDFCKRVSLATVDKTVETPSPHYHHEHHHNHGHQHLGSSELSENQQPGAPNAPTHPAPPGLHHHHKHKGQHRQGHPENRDMPASEDLQDLQKKLCRKRCINQLLCKLP |
◆ Recombinant Proteins | ||
Selenop-4849M | Recombinant Mouse Selenop protein | +Inquiry |
SELENOP-2778H | Recombinant Human SELENOP protein(181-290 aa), C-His-tagged | +Inquiry |
Selenop-4850M | Recombinant Mouse Selenop protein | +Inquiry |
SELENOP-3477B | Recombinant Bovine SELENOP protein, GST-tagged | +Inquiry |
SELENOP-1823H | Recombinant Human SELENOP protein, His-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SELENOP Products
Required fields are marked with *
My Review for All SELENOP Products
Required fields are marked with *