Recombinant Human Serine/Threonine Kinase 38, His-tagged

• Cat.No.: STK38-1178H
• Product Overview: Recombinant Human Serine/Threonine Kinase 38(325-465 aa), fused with His tag, was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 325-465 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 300mM imidazole.
• AA Sequence: ETPQETYKKVMNWKETLTFPPEVPISEKAKDLILRFCCEWEHRIGAPGVEEIKSNSFFEGVDWEHIRERPAAISIEIKSIDDTSNFDEFPESDILKPTVATSNHPETDYKNKDWVFINYTYKRFEGLTARGAIPSYMKAAK
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: STK38 serine/threonine kinase 38 [ Homo sapiens ]
• Official Symbol: STK38
• Synonyms: STK38; serine/threonine kinase 38; serine/threonine-protein kinase 38; NDR; NDR1 protein kinase; nuclear Dbf2-related 1; nuclear Dbf2-related kinase 1; Ndr Ser/Thr kinase-like protein; serine threonine protein kinase; NDR1
• Gene ID: 11329
• mRNA Refseq: NM_007271
• Protein Refseq: NP_009202
• MIM: 606964
• UniProt ID: Q15208