"SERPINI2" Related Products

Expand

Recombinant Human SERPINI2 protein, T7/His-tagged

Cat.No.: SERPINI2-59H
Product Overview: Recombinant human SERPINI2 cDNA (19 - 405 aa, Isoform-II, derived from BC027859) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
Source: E. coli
Species: Human
Tag: T7/His
Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFCSAMKNTEFAVDLYQEVSLSHKDNIIFSPLGITLVLEMVQLGAKGK AQQQIRQTLKQQETSAGEEFFVLKSFFSAISEKKQEFTFNLANALYLQEGFTVKEQYLHGNKEFFQSAIKLVDFQ DAKACAEMISTWVERKTDGKIKDMFSGEEFGPLTRLVLVNAIYFKGDWKQKFRKEDTQLINFTKKNGSTVKIPMM KALLRTKYGYFSESSLNYQVLELSYKGDEFSLIIILPAEGMDIEEVEKLITAQQILKWLSEMQEEEVEISLPRFK VEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVFFEINEDGSEAATSTGIHIPVIMSLAQSQFI ANHPFLFIMKHNPTESILFMGRVTNPDTQEIKGRDLDSL
Purity: >90% by SDS-PAGE
Applications: 1. May be used for in vitro SERPINI2 mediated cancer cell metastasis regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as SERPINI2 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As antigen for specific antibody production.
Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name: SERPINI2 serpin peptidase inhibitor, clade I (pancpin), member 2 [ Homo sapiens ]
Official Symbol: SERPINI2
Synonyms: SERPINI2; serpin peptidase inhibitor, clade I (pancpin), member 2; PI14, serine (or cysteine) proteinase inhibitor, clade I (neuroserpin), member 2 , serine (or cysteine) proteinase inhibitor, clade I (pancpin), member 2; serpin I2; MEPI; PANCPIN; pancp
Gene ID: 5276
mRNA Refseq: NM_006217
Protein Refseq: NP_006208
MIM: 605587
UniProt ID: O75830
Chromosome Location: 3q26
Function: peptidase inhibitor activity; serine-type endopeptidase inhibitor activity;

Online Inquiry

Note: There will be extra charge for optional service!
Optional requirements on this protein    +Expand
C-fusion    N-fusion   Non-tagged
His    GST   Fc   Others
<1.0 eu/μg    <0.1 eu/μg   <0.01 eu/μg   Not required
Monomer Isolation    Dimer Isolation    Not required
>80% by SDS-PAGE    >90% by SDS-PAGE   >95% by SDS-PAGE   Others

Please input "biomart" as verification code. Please review Creative BioMart's privacy policy for more information


Price does not include shipping and packaging costs.Request quote for final price.

Price Inquiry

Welcome! For price inquiries, please feel free to contact us through the form below. We will get back to you as soon as possible.