Recombinant Human SERPINI2 protein, T7/His-tagged

Cat.No. : SERPINI2-59H
Product Overview : Recombinant human SERPINI2 cDNA (19 - 405 aa, Isoform-II, derived from BC027859) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His&T7
Protein Length : 19-405 a.a.
Form : 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
AA Sequence : MASMTGGQQMGRGHHHHHHENLYFQGGEFCSAMKNTEFAVDLYQEVSLSHKDNIIFSPLGITLVLEMVQLGAKGK AQQQIRQTLKQQETSAGEEFFVLKSFFSAISEKKQEFTFNLANALYLQEGFTVKEQYLHGNKEFFQSAIKLVDFQ DAKACAEMISTWVERKTDGKIKDMFSGEEFGPLTRLVLVNAIYFKGDWKQKFRKEDTQLINFTKKNGSTVKIPMM KALLRTKYGYFSESSLNYQVLELSYKGDEFSLIIILPAEGMDIEEVEKLITAQQILKWLSEMQEEEVEISLPRFK VEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVFFEINEDGSEAATSTGIHIPVIMSLAQSQFI ANHPFLFIMKHNPTESILFMGRVTNPDTQEIKGRDLDSL
Purity : >90% by SDS-PAGE
Applications : 1. May be used for in vitro SERPINI2 mediated cancer cell metastasis regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as SERPINI2 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As antigen for specific antibody production.
Storage : Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.
Gene Name SERPINI2 serpin peptidase inhibitor, clade I (pancpin), member 2 [ Homo sapiens ]
Official Symbol SERPINI2
Synonyms SERPINI2; serpin peptidase inhibitor, clade I (pancpin), member 2; PI14, serine (or cysteine) proteinase inhibitor, clade I (neuroserpin), member 2 , serine (or cysteine) proteinase inhibitor, clade I (pancpin), member 2; serpin I2; MEPI; PANCPIN; pancp
Gene ID 5276
mRNA Refseq NM_006217
Protein Refseq NP_006208
MIM 605587
UniProt ID O75830
Chromosome Location 3q26
Function peptidase inhibitor activity; serine-type endopeptidase inhibitor activity;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SERPINI2 Products

Required fields are marked with *

My Review for All SERPINI2 Products

Required fields are marked with *

0
cart-icon
0
compare icon