Recombinant Human SERPINI2 protein, T7/His-tagged

• Cat.No.: SERPINI2-59H
• Product Overview: Recombinant human SERPINI2 cDNA (19 - 405 aa, Isoform-II, derived from BC027859) fused with T7-His-TEV cleavage site Tag (29aa) at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Protein Length: 19-405 a.a.
• Form: 0.5 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, arginine, DTT and Glycerol.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFCSAMKNTEFAVDLYQEVSLSHKDNIIFSPLGITLVLEMVQLGAKGK AQQQIRQTLKQQETSAGEEFFVLKSFFSAISEKKQEFTFNLANALYLQEGFTVKEQYLHGNKEFFQSAIKLVDFQ DAKACAEMISTWVERKTDGKIKDMFSGEEFGPLTRLVLVNAIYFKGDWKQKFRKEDTQLINFTKKNGSTVKIPMM KALLRTKYGYFSESSLNYQVLELSYKGDEFSLIIILPAEGMDIEEVEKLITAQQILKWLSEMQEEEVEISLPRFK VEQKVDFKDVLYSLNITEIFSGGCDLSGITDSSEVYVSQVTQKVFFEINEDGSEAATSTGIHIPVIMSLAQSQFI ANHPFLFIMKHNPTESILFMGRVTNPDTQEIKGRDLDSL
• Purity: >90% by SDS-PAGE
• Applications: 1. May be used for in vitro SERPINI2 mediated cancer cell metastasis regulation study with this protein as either coating matrix protein or soluble factor.2. May be used as SERPINI2 protein-protein interaction assay.3. As enzymatic substrate for various proteases.4. As antigen for specific antibody production.
• Storage: Keep at -80centigrade for long term storage. Product is stable at 4 centigrade for at least 30 days.

Gene Information

• Gene Name: SERPINI2 serpin peptidase inhibitor, clade I (pancpin), member 2 [ Homo sapiens ]
• Official Symbol: SERPINI2
• Synonyms: SERPINI2; serpin peptidase inhibitor, clade I (pancpin), member 2; PI14, serine (or cysteine) proteinase inhibitor, clade I (neuroserpin), member 2 , serine (or cysteine) proteinase inhibitor, clade I (pancpin), member 2; serpin I2; MEPI; PANCPIN; pancp
• Gene ID: 5276
• mRNA Refseq: NM_006217
• Protein Refseq: NP_006208
• MIM: 605587
• UniProt ID: O75830
• Chromosome Location: 3q26
• Function: peptidase inhibitor activity; serine-type endopeptidase inhibitor activity