Recombinant Human SERTAD2 protein, T7/His-tagged
| Cat.No. : | SERTAD2-208H |
| Product Overview : | Recombinant human TRIP-Br2 (313aa, derived from BC074789) fused with T7-His-TEV cleavage site Tag at N-terminal was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His&T7 |
| Form : | 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT. |
| AA Sequence : | MASMTGGQQMGRGHHHHHHENLYFQGGEFLGKGGKRKFDEHEDGLEGKIVSPCDGPSKVSYTLQRQTIFNISLMK LYNHRPLTEPSLQKTVLINNMLRRIQEELKQEGSLRPMFTPSSQPTTEPSDSYREAPPAFSHLASPSSHPCDLGS TTPLEACLTPASLLEDDDDTFCTSQAMQPTAPTKLSPPALLPEKDSFSSALDEIEELCPTSTSTEAATAATDSVK GTSSEAGTQKLDGPQESRADDSKLMDSLPGNFEITTSTGFLTDLTLDDILFADIDTSMYDFDPCTSSSGTASKMA PVSADDLLKTLAPYSSQPVTPSQPFKMDLTELDHIMEVLVGS |
| Purity : | >90% by SDS-PAGE. |
| Storage : | Keep at -80°C for long term storage. Product is stable at 4 °C for at least 30 days. |
| Gene Name | SERTAD2 SERTA domain containing 2 [ Homo sapiens ] |
| Official Symbol | SERTAD2 |
| Synonyms | SERTAD2; SERTA domain containing 2; SERTA domain-containing protein 2; KIAA0127; Sei 2; TRIP Br2; Sei-2; TRIP-Br2; MGC126688; MGC126690; |
| Gene ID | 9792 |
| mRNA Refseq | NM_014755 |
| Protein Refseq | NP_055570 |
| MIM | |
| UniProt ID | Q14140 |
| Chromosome Location | 2p15 |
| Function | transcription coactivator activity; |
| ◆ Recombinant Proteins | ||
| SERTAD2-3975R | Recombinant Rhesus Macaque SERTAD2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SERTAD2-4158R | Recombinant Rhesus monkey SERTAD2 Protein, His-tagged | +Inquiry |
| SERTAD2-208H | Recombinant Human SERTAD2 protein, T7/His-tagged | +Inquiry |
| SERTAD2-2717C | Recombinant Chicken SERTAD2 | +Inquiry |
| SERTAD2-268H | Recombinant Human SERTAD2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SERTAD2-1934HCL | Recombinant Human SERTAD2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SERTAD2 Products
Required fields are marked with *
My Review for All SERTAD2 Products
Required fields are marked with *
