Recombinant Human SFXN3 Protein, His-tagged
| Cat.No. : | SFXN3-2627H |
| Product Overview : | Recombinant Human SFXN3 Protein(1-145 aa), fused with N-terminal His tag, was expressed in E.coli. |
| Availability | June 12, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | His |
| Protein Length : | 1-145 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| AASequence : | MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRSGDTPI |
| Purity : | 85%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| Gene Name | SFXN3 sideroflexin 3 [ Homo sapiens ] |
| Official Symbol | SFXN3 |
| Synonyms | SFXN3; sideroflexin 3; sideroflexin-3; SFX3; BA108L7.2; |
| Gene ID | 81855 |
| mRNA Refseq | NM_030971 |
| Protein Refseq | NP_112233 |
| UniProt ID | Q9BWM7 |
| ◆ Recombinant Proteins | ||
| SFXN3-5142Z | Recombinant Zebrafish SFXN3 | +Inquiry |
| SFXN3-1008H | Recombinant Human SFXN3 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| RFL25737RF | Recombinant Full Length Rat Sideroflexin-3(Sfxn3) Protein, His-Tagged | +Inquiry |
| Sfxn3-5819M | Recombinant Mouse Sfxn3 Protein, Myc/DDK-tagged | +Inquiry |
| RFL35753BF | Recombinant Full Length Bovine Sideroflexin-3(Sfxn3) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SFXN3-1893HCL | Recombinant Human SFXN3 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SFXN3 Products
Required fields are marked with *
My Review for All SFXN3 Products
Required fields are marked with *
