Recombinant Human SFXN3 Protein, His-tagged

Cat.No. : SFXN3-2627H
Product Overview : Recombinant Human SFXN3 Protein(1-145 aa), fused with N-terminal His tag, was expressed in E.coli.
Availability June 12, 2026
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-145 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
AASequence : MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRSGDTPI
Purity : 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
Reconstitution : Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.
Gene Name SFXN3 sideroflexin 3 [ Homo sapiens ]
Official Symbol SFXN3
Synonyms SFXN3; sideroflexin 3; sideroflexin-3; SFX3; BA108L7.2;
Gene ID 81855
mRNA Refseq NM_030971
Protein Refseq NP_112233
UniProt ID Q9BWM7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SFXN3 Products

Required fields are marked with *

My Review for All SFXN3 Products

Required fields are marked with *

0
cart-icon
0
compare icon