Recombinant Human SFXN3 Protein, His-tagged

• Cat.No.: SFXN3-2627H
• Product Overview: Recombinant Human SFXN3 Protein(1-145 aa), fused with N-terminal His tag, was expressed in E.coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His
• Protein Length: 1-145 aa
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
• AASequence: MESKMGELPLDINIQEPRWDQSTFLGRARHFFTVTDPRNLLLSGAQLEASRNIVQNYRAGVVTPGITEDQLWRAKYVYDSAFHPDTGEKVVLIGRMSAQVPMNMTITGCMLTFYRKTPTVVFWQWVNQSFNAIVNYSNRSGDTPI
• Purity: 85%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage.

Gene Information

• Gene Name: SFXN3 sideroflexin 3 [ Homo sapiens ]
• Official Symbol: SFXN3
• Synonyms: SFXN3; sideroflexin 3; sideroflexin-3; SFX3; BA108L7.2
• Gene ID: 81855
• mRNA Refseq: NM_030971
• Protein Refseq: NP_112233
• UniProt ID: Q9BWM7