Recombinant Human SIVA1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SIVA1-4967H
Product Overview : SIVA1 MS Standard C13 and N15-labeled recombinant protein (NP_006418) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes an E3 ubiquitin ligase that regulates cell cycle progression, cell proliferation and apoptosis. The N-terminus of this protein binds to the cytoplasmic tail of the CD27 antigen, a member of the tumor necrosis factor receptor (TNFR) superfamily. In response to UV radiation-induced DNA damage, this protein has been shown to mediate the ubiquitination of proliferating cell nuclear antigen (PCNA), an important step in translesion DNA synthesis.
Molecular Mass : 18.5 kDa
AA Sequence : MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFEKTKRLLFLGAQAYLDHVWDEGCAVVHLPESPKPGPTGAPRAARGQMLIGPDGRLIRSLGQASEADPSGVASIACSSCVRAVDGKAVCGQCERALCGQCVRTCWGCGSVACTLCGLVDCSDMYEKVLCTSCAMFETTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SIVA1 SIVA1 apoptosis inducing factor [ Homo sapiens (human) ]
Official Symbol SIVA1
Synonyms SIVA1; SIVA1, apoptosis-inducing factor; apoptosis regulatory protein Siva; CD27BP; SIVA; Siva 1; Siva 2; CD27-binding (Siva) protein; Siva-1; Siva-2;
Gene ID 10572
mRNA Refseq NM_006427
Protein Refseq NP_006418
MIM 605567
UniProt ID O15304

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SIVA1 Products

Required fields are marked with *

My Review for All SIVA1 Products

Required fields are marked with *

0
cart-icon