Recombinant Human SIVA1 protein, His-tagged
Cat.No. : | SIVA1-6743H |
Product Overview : | Recombinant Human SIVA1 protein(1-114 aa), fused with N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E. coli |
Tag : | His |
Protein Length : | 1-114 aa |
Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 7.4). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. The protein was eluted with a buffer containing 300 mM imidazole. |
AASequence : | MPKRSCPFADVAPLQLKVRVSQRELSRGVCAERYSQEVFDPSGVASIACSSCVRAVDGKAVCGQCERA |
Purity : | 85%, by SDS-PAGE. |
Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
Reconstitution : | It is recommended that sterile water be added to the vial to prepare a stock solution of 0.25 ug/ul. Centrifuge the vial at 4°C before opening to recover the entire contents. |
Gene Name | SIVA1 SIVA1, apoptosis-inducing factor [ Homo sapiens ] |
Official Symbol | SIVA1 |
Synonyms | SIVA1; SIVA1, apoptosis-inducing factor; apoptosis regulatory protein Siva; CD27BP; SIVA; Siva 1; Siva 2; CD27-binding (Siva) protein; Siva-1; Siva-2; |
mRNA Refseq | NM_006427 |
Protein Refseq | NP_006418 |
MIM | 605567 |
UniProt ID | O15304 |
Gene ID | 10572 |
◆ Recombinant Proteins | ||
SIVA1-15160M | Recombinant Mouse SIVA1 Protein | +Inquiry |
SIVA1-4209R | Recombinant Rhesus monkey SIVA1 Protein, His-tagged | +Inquiry |
SIVA1-6743H | Recombinant Human SIVA1 protein, His-tagged | +Inquiry |
SIVA1-3584H | Recombinant Human SIVA1, His-tagged | +Inquiry |
Siva1-3583M | Recombinant Mouse Siva1, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SIVA1-1826HCL | Recombinant Human SIVA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SIVA1 Products
Required fields are marked with *
My Review for All SIVA1 Products
Required fields are marked with *