Recombinant Human SKA1 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SKA1-878H |
Product Overview : | SKA1 MS Standard C13 and N15-labeled recombinant protein (NP_001034624) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | SKA1 (Spindle And Kinetochore Associated Complex Subunit 1) is a Protein Coding gene. Diseases associated with SKA1 include Adenoid Cystic Carcinoma and Acute Poststreptococcal Glomerulonephritis. Among its related pathways are Signaling by GPCR and Mitotic Prometaphase. Gene Ontology (GO) annotations related to this gene include microtubule binding. |
Molecular Mass : | 29.5 kDa |
AA Sequence : | MASSDLEQLCSHVNEKIGNIKKTLSLRNCGQEPTLKTVLNKIGDEIIVINELLNKLELEIQYQEQTNNSLKELCESLEEDYKDIEHLKENVPSHLPQVTVTQSCVKGSDLDPEEPIKVEEPEPVKKPPKEQRSIKEMPFITCDEFNGVPSYMKSRLTYNQINDVIKEINKAVISKYKILHQPKKSMNSVTRNLYHRFIDEETKDTKGRYFIVEADIKEFTTLKADKKFHVLLNILRHCRRLSEVRGGGLTRYVITTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SKA1 spindle and kinetochore associated complex subunit 1 [ Homo sapiens (human) ] |
Official Symbol | SKA1 |
Synonyms | SKA1; spindle and kinetochore associated complex subunit 1; C18orf24, chromosome 18 open reading frame 24; spindle and kinetochore-associated protein 1; MGC10200; spindle and KT (kinetochore) associated 1; C18orf24; |
Gene ID | 220134 |
mRNA Refseq | NM_001039535 |
Protein Refseq | NP_001034624 |
MIM | 616673 |
UniProt ID | Q96BD8 |
◆ Recombinant Proteins | ||
SKA1-8190M | Recombinant Mouse SKA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Ska1-5891M | Recombinant Mouse Ska1 Protein, Myc/DDK-tagged | +Inquiry |
SKA1-5071R | Recombinant Rat SKA1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SKA1-1350H | Recombinant Human SKA1 | +Inquiry |
SKA1-1520H | Recombinant Human SKA1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
SKA1-1820HCL | Recombinant Human SKA1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SKA1 Products
Required fields are marked with *
My Review for All SKA1 Products
Required fields are marked with *