Recombinant Human SKA2 Protein, GST-tagged

Cat.No. : SKA2-3748H
Product Overview : Human FAM33A full-length ORF (BAG51725.1, 1 a.a. - 121 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : SKA2 (Spindle And Kinetochore Associated Complex Subunit 2) is a Protein Coding gene. Diseases associated with SKA2 include Post-Traumatic Stress Disorder. Among its related pathways are Mitotic Metaphase and Anaphase and Signaling by GPCR. GO annotations related to this gene include microtubule binding.
Molecular Mass : 40.6 kDa
AA Sequence : MEAEVDKLELMFQKAESDLDYIQYRLEYEIKTNHPDSASEKNPVTLLKELSVIKSRYQTLYARFKPVAVEQKESKSRICATAKKTMNMIQKLQKQTDLELSPLTKEEKTAAEQFKFHMPDL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name SKA2 spindle and kinetochore associated complex subunit 2 [ Homo sapiens (human) ]
Official Symbol SKA2
Synonyms SKA2; spindle and kinetochore associated complex subunit 2; Spindle And Kinetochore Associated Complex Subunit 2; Family With Sequence Similarity 33, Member A; FAM33A; Spindle And Kinetochore-Associated Protein 2; Spindle And KT (Kinetochore) Associated 2; Protein FAM33A; spindle and kinetochore-associated protein 2; family with sequence similarity 33, member A; spindle and KT (kinetochore) associated 2
Gene ID 348235
mRNA Refseq NM_001100595
Protein Refseq NP_001094065
MIM 616674
UniProt ID Q8WVK7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SKA2 Products

Required fields are marked with *

My Review for All SKA2 Products

Required fields are marked with *

0
cart-icon