Recombinant Human SKAP2 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SKAP2-1397H |
| Product Overview : | SKAP2 MS Standard C13 and N15-labeled recombinant protein (NP_003921) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | HEK293 |
| Tag : | DDK&Myc |
| Description : | The protein encoded by this gene shares homology with Src kinase-associated phosphoprotein 1, and is a substrate of Src family kinases. It is an adaptor protein that is thought to play an essential role in the Src signaling pathway, and in regulating proper activation of the immune system. This protein contains an amino terminal coiled-coil domain for self-dimerization, a plecskstrin homology (PH) domain required for interactions with lipids at the membrane, and a Src homology (SH3) domain at the carboxy terminus. Some reports indicate that this protein inhibits actin polymerization through interactions with actin assembly factors, and might negatively regulate the invasiveness of tumors by modulating actin assembly. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Molecular Mass : | 41.2 kDa |
| AA Sequence : | MPNPSSTSSPYPLPEEIRNLLADVETFVADILKGENLSKKAKEKRESLIKKIKDVKSIYLQEFQDKGDAEDGEEYDDPFAGPPDTISLASERYDKDDEAPSDGAQFPPIAAQDLPFVLKAGYLEKRRKDHSFLGFEWQKRWCALSKTVFYYYGSDKDKQQKGEFAIDGYSVRMNNTLRKDGKKDCCFEISAPDKRIYQFTAASPKDAEEWVQQLKFVLQDMESDIIPEDYDERGELYDDVDHPLPISNPLTSSQPIDDEIYEELPEEEEDSAPVKVEEQRKMSQDSVHHTSGDKSTDYANFYQGLWDCTGAFSDELSFKRGDVIYILSKEYNRYGWWVGEMKGAIGLVPKAYIMEMYDITRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
| Concentration : | 50 μg/mL as determined by BCA |
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
| Gene Name | SKAP2 src kinase associated phosphoprotein 2 [ Homo sapiens (human) ] |
| Official Symbol | SKAP2 |
| Synonyms | SKAP2; src kinase associated phosphoprotein 2; SCAP2, src family associated phosphoprotein 2; src kinase-associated phosphoprotein 2; RA70; SAPS; SKAP HOM; SKAP55R; SKAP-55HOM; SKAP55 homolog; Pyk2/RAFTK-associated protein; src-associated adaptor protein; retinoic acid-induced protein 70; src family associated phosphoprotein 2; src family-associated phosphoprotein 2; Fyn-associated phosphoprotein SKAP55 homologue; src-associated adapter protein with PH and SH3 domains; src kinase-associated phosphoprotein 55-related protein; src kinase-associated phosphoprotein of 55-related protein; PRAP; SCAP2; SKAP-HOM; MGC10411; MGC33304; |
| Gene ID | 8935 |
| mRNA Refseq | NM_003930 |
| Protein Refseq | NP_003921 |
| MIM | 605215 |
| UniProt ID | O75563 |
| ◆ Recombinant Proteins | ||
| SKAP2-4214R | Recombinant Rhesus monkey SKAP2 Protein, His-tagged | +Inquiry |
| SKAP2-4030R | Recombinant Rhesus Macaque SKAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SKAP2-190H | Recombinant Human SKAP2, His-tagged | +Inquiry |
| SKAP2-10901Z | Recombinant Zebrafish SKAP2 | +Inquiry |
| SKAP2-5415R | Recombinant Rat SKAP2 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SKAP2-1816HCL | Recombinant Human SKAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SKAP2 Products
Required fields are marked with *
My Review for All SKAP2 Products
Required fields are marked with *
