Recombinant Human SLC15A1
Cat.No. : | SLC15A1-30924TH |
Product Overview : | Recombinant fragment (amino acids 473-572) of Human SLC15A1 with a proprietary tag at the N terminal; Predicted MW 36.63 kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | Non |
Protein Length : | 100 amino acids |
Description : | This gene encodes an intestinal hydrogen peptide cotransporter that is a member of the solute carrier family 15. The encoded protein is localized to the brush border membrane of the intestinal epithelium and mediates the uptake of di- and tripeptides from the lumen into the enterocytes. This protein plays an important role in the uptake and digestion of dietary proteins. This protein also facilitates the absorption of numerous peptidomimetic drugs. |
Molecular Weight : | 36.630kDa inclusive of tags |
Form : | Liquid |
Purity : | Proprietary Purification |
Storage buffer : | pH: 8.00Constituents:0.3% Glutathione, 0.79% Tris HCl |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80oC. Avoid freeze / thaw cycles. |
Sequences of amino acids : | VKDGLNQKPEKGENGIRFVNTFNELITITMSGKVYANISSYNASTYQFFPSGIKGFTISSTEIPPQCQPNFNTFYLEFGSAYTYIVQRKNDSCPEVKVFE |
Sequence Similarities : | Belongs to the PTR2/POT transporter (TC 2.A.17) family. |
Gene Name | SLC15A1 solute carrier family 15 (oligopeptide transporter), member 1 [ Homo sapiens ] |
Official Symbol | SLC15A1 |
Synonyms | SLC15A1; solute carrier family 15 (oligopeptide transporter), member 1; solute carrier family 15 member 1; bA551M18.1.1 (solute carrier family 15 (oligopeptide transporter) member 1); HPECT1; HPEPT1; PEPT1; peptide transporter HPEPT1; solute carrier famil |
Gene ID | 6564 |
mRNA Refseq | NM_005073 |
Protein Refseq | NP_005064 |
MIM | 600544 |
Uniprot ID | P46059 |
Chromosome Location | 13q33-q34 |
Pathway | Protein digestion and absorption, organism-specific biosystem; Protein digestion and absorption, conserved biosystem; Proton/oligonucleotide cotransporters, organism-specific biosystem; SLC-mediated transmembrane transport, organism-specific biosystem; Transmembrane transport of small molecules, organism-specific biosystem; |
Function | molecular_function; oligopeptide transporter activity; peptide:hydrogen symporter activity; symporter activity; transporter activity; |
◆ Recombinant Proteins | ||
SLC15A1-5434R | Recombinant Rat SLC15A1 Protein | +Inquiry |
SLC15A1-8527Z | Recombinant Zebrafish SLC15A1 | +Inquiry |
SLC15A1-5936C | Recombinant Chicken SLC15A1 | +Inquiry |
SLC15A1-4221R | Recombinant Rhesus monkey SLC15A1 Protein, His-tagged | +Inquiry |
SLC15A1-5093R | Recombinant Rat SLC15A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All SLC15A1 Products
Required fields are marked with *
My Review for All SLC15A1 Products
Required fields are marked with *
0
Inquiry Basket