Recombinant Human SLC1A6 protein, GST-tagged
| Cat.No. : | SLC1A6-3497H |
| Product Overview : | Recombinant Human SLC1A6 protein(P48664)(149-271aa), fused to N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 149-271aa |
| Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
| Molecular Mass : | 40.4 kDa |
| AA Sequence : | MVTIIHPGKGSKEGLHREGRIETIPTADAFMDLIRNMFPPNLVEACFKQFKTQYSTRVVTRTMVRTENGSEPGASMPPPFSVENGTSFLENVTRALGTLQEMLSFEETVPVPGSANGINALGL |
| Purity : | Greater than 90% as determined by SDS-PAGE. |
| Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
| Reconstitution : | Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. |
| Gene Name | SLC1A6 solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6 [ Homo sapiens ] |
| Official Symbol | SLC1A6 |
| Synonyms | SLC1A6; solute carrier family 1 (high affinity aspartate/glutamate transporter), member 6; excitatory amino acid transporter 4; EAAT4; solute carrier family 1 member 6; sodium-dependent glutamate/aspartate transporter; MGC33092; MGC43671; |
| Gene ID | 6511 |
| mRNA Refseq | NM_005071 |
| Protein Refseq | NP_005062 |
| MIM | 600637 |
| UniProt ID | P48664 |
| ◆ Recombinant Proteins | ||
| SLC1A6-5106R | Recombinant Rat SLC1A6 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC1A6-5447R | Recombinant Rat SLC1A6 Protein | +Inquiry |
| SLC1A6-1214H | Recombinant Human SLC1A6 Protein (S2-M564), 8×His-MBP, Flag tagged | +Inquiry |
| SLC1A6-3497H | Recombinant Human SLC1A6 protein, GST-tagged | +Inquiry |
| SLC1A6-6048Z | Recombinant Zebrafish SLC1A6 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC1A6-600HCL | Recombinant Human SLC1A6 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC1A6 Products
Required fields are marked with *
My Review for All SLC1A6 Products
Required fields are marked with *
