Recombinant Human SLC2A5 protein, GST-tagged

• Cat.No.: SLC2A5-1888H
• Product Overview: Recombinant Human SLC2A5 protein(357-399 aa), fused to GST tag, was expressed in E. coli.

Specification

• Source: E. coli
• Species: Human
• Tag: GST
• Form: The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH.
• Protein length: 357-399 aa
• AA Sequence: CVLTAALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLI
• Purity: 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
• Storage: Short-term storage: Store at 2-8°C for (1-2 weeks).
  Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles.
• Reconstitution: Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage.
  Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage.

Gene Information

• Gene Name: SLC2A5 solute carrier family 2 (facilitated glucose/fructose transporter), member 5 [ Homo sapiens ]
• Official Symbol: SLC2A5
• Synonyms: SLC2A5; solute carrier family 2 (facilitated glucose/fructose transporter), member 5; GLUT5; solute carrier family 2, facilitated glucose transporter member 5; glucose transporter-like protein 5; glucose transporter type 5, small intestine; GLUT-5
• Gene ID: 6518
• mRNA Refseq: NM_001135585
• Protein Refseq: NP_001129057
• MIM: 138230
• UniProt ID: P22732