Recombinant Human SLC2A5 protein, GST-tagged
| Cat.No. : | SLC2A5-1888H |
| Product Overview : | Recombinant Human SLC2A5 protein(357-399 aa), fused to GST tag, was expressed in E. coli. |
| Availability | February 10, 2026 |
| Unit | |
| Price | |
| Qty |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 357-399 aa |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8.). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. The elution buffer contain 100mM GSH. |
| AA Sequence : | CVLTAALALQDTVSWMPYISIVCVISYVIGHALGPSPIPALLI |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, buffer containing 50% glycerol is recommended for reconstitution. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 µg/μl in 200 μl sterile water for short-term storage. Reconstitution with 200 μl 50% glycerol solution is recommended for longer term storage. |
| Gene Name | SLC2A5 solute carrier family 2 (facilitated glucose/fructose transporter), member 5 [ Homo sapiens ] |
| Official Symbol | SLC2A5 |
| Synonyms | SLC2A5; solute carrier family 2 (facilitated glucose/fructose transporter), member 5; GLUT5; solute carrier family 2, facilitated glucose transporter member 5; glucose transporter-like protein 5; glucose transporter type 5, small intestine; GLUT-5; |
| Gene ID | 6518 |
| mRNA Refseq | NM_001135585 |
| Protein Refseq | NP_001129057 |
| MIM | 138230 |
| UniProt ID | P22732 |
| ◆ Recombinant Proteins | ||
| SLC2A5-2747H | Recombinant Human SLC2A5, GST-tagged | +Inquiry |
| SLC2A5-1600HFL | Recombinant Full Length Human SLC2A5 Protein, C-Flag-tagged | +Inquiry |
| SLC2A5-5499R | Recombinant Rat SLC2A5 Protein | +Inquiry |
| SLC2A5-1888H | Recombinant Human SLC2A5 protein, GST-tagged | +Inquiry |
| SLC2A5-15366M | Recombinant Mouse SLC2A5 Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| SLC2A5-1740HCL | Recombinant Human SLC2A5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC2A5 Products
Required fields are marked with *
My Review for All SLC2A5 Products
Required fields are marked with *
