Recombinant Human SLC30A8 protein, His&Myc-tagged
Cat.No. : | SLC30A8-5253H |
Product Overview : | Recombinant Human SLC30A8 protein(Q8IWU4)(267-369aa), fused with N-terminal His tag and C-terminal Myc tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His&Myc |
Protein Length : | 267-369aa |
Form : | If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0. |
Molecular Mass : | 18.8 kDa |
Purity : | Greater than 85% as determined by SDS-PAGE. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. |
AA Sequence : | LKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD |
Gene Name | SLC30A8 solute carrier family 30 (zinc transporter), member 8 [ Homo sapiens ] |
Official Symbol | SLC30A8 |
Synonyms | SLC30A8; solute carrier family 30 (zinc transporter), member 8; zinc transporter 8; zinc transporter ZnT-8; ZNT8; ZnT-8; |
Gene ID | 169026 |
mRNA Refseq | NM_001172811 |
Protein Refseq | NP_001166282 |
MIM | 611145 |
UniProt ID | Q8IWU4 |
◆ Recombinant Proteins | ||
SLC30A8-5165R | Recombinant Rat SLC30A8 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC30A8-0476H | Recombinant Human SLC30A8 Protein (E2-D369), 8×His-MBP, Flag tagged | +Inquiry |
RFL27184MF | Recombinant Full Length Mouse Zinc Transporter 8(Slc30A8) Protein, His-Tagged | +Inquiry |
SLC30A8-2448H | Recombinant Human SLC30A8/ZNT8 protein, His-tagged | +Inquiry |
RFL9428RF | Recombinant Full Length Rat Zinc Transporter 8(Slc30A8) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC30A8-1737HCL | Recombinant Human SLC30A8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC30A8 Products
Required fields are marked with *
My Review for All SLC30A8 Products
Required fields are marked with *