Recombinant Human SLC30A8/ZNT8 Protein

Cat.No. : SLC30A8-140H
Product Overview : Recombinant Human SLC30A8 Protein was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Description : The protein encoded by this gene is a zinc efflux transporter involved in the accumulation of zinc in intracellular vesicles. This gene is expressed at a high level only in the pancreas, particularly in islets of Langerhans. The encoded protein colocalizes with insulin in the secretory pathway granules of the insulin-secreting INS-1 cells. Allelic variants of this gene exist that confer susceptibility to diabetes mellitus, noninsulin-dependent (NIDDM). Several transcript variants encoding different isoforms have been found for this gene.
Form : PBS, pH 7.4.
Molecular Mass : 28 kDa
AA Sequence : MKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASWDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD
Purity : >90%
Storage : Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.
Gene Name SLC30A8 solute carrier family 30 member 8 [ Homo sapiens (human) ]
Official Symbol SLC30A8
Synonyms ZNT8; ZnT-8
Gene ID 169026
mRNA Refseq NM_001172811
Protein Refseq NP_001166282
MIM 611145
UniProt ID Q8IWU4

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SLC30A8 Products

Required fields are marked with *

My Review for All SLC30A8 Products

Required fields are marked with *

0
cart-icon