Recombinant Human SLC30A8/ZNT8 Protein
Cat.No. : | SLC30A8-140H |
Product Overview : | Recombinant Human SLC30A8 Protein was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Description : | The protein encoded by this gene is a zinc efflux transporter involved in the accumulation of zinc in intracellular vesicles. This gene is expressed at a high level only in the pancreas, particularly in islets of Langerhans. The encoded protein colocalizes with insulin in the secretory pathway granules of the insulin-secreting INS-1 cells. Allelic variants of this gene exist that confer susceptibility to diabetes mellitus, noninsulin-dependent (NIDDM). Several transcript variants encoding different isoforms have been found for this gene. |
Form : | PBS, pH 7.4. |
Molecular Mass : | 28 kDa |
AA Sequence : | MKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASWDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD |
Purity : | >90% |
Storage : | Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles. |
Gene Name | SLC30A8 solute carrier family 30 member 8 [ Homo sapiens (human) ] |
Official Symbol | SLC30A8 |
Synonyms | ZNT8; ZnT-8 |
Gene ID | 169026 |
mRNA Refseq | NM_001172811 |
Protein Refseq | NP_001166282 |
MIM | 611145 |
UniProt ID | Q8IWU4 |
◆ Recombinant Proteins | ||
SLC30A8-5165R | Recombinant Rat SLC30A8 Protein, His (Fc)-Avi-tagged | +Inquiry |
Slc30a8-4560M | Recombinant Mouse Slc30a8/ZNT8 protein, His-tagged | +Inquiry |
RFL27184MF | Recombinant Full Length Mouse Zinc Transporter 8(Slc30A8) Protein, His-Tagged | +Inquiry |
RFL34107HF | Recombinant Full Length Human Zinc Transporter 8(Slc30A8) Protein, His-Tagged | +Inquiry |
SLC30A8-15379M | Recombinant Mouse SLC30A8/ZNT8 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
SLC30A8-1737HCL | Recombinant Human SLC30A8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC30A8 Products
Required fields are marked with *
My Review for All SLC30A8 Products
Required fields are marked with *
0
Inquiry Basket