Recombinant Human SLC30A8/ZNT8 Protein

• Cat.No.: SLC30A8-140H
• Product Overview: Recombinant Human SLC30A8 Protein was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Protein Length: 268-369 aa
• Description: The protein encoded by this gene is a zinc efflux transporter involved in the accumulation of zinc in intracellular vesicles. This gene is expressed at a high level only in the pancreas, particularly in islets of Langerhans. The encoded protein colocalizes with insulin in the secretory pathway granules of the insulin-secreting INS-1 cells. Allelic variants of this gene exist that confer susceptibility to diabetes mellitus, noninsulin-dependent (NIDDM). Several transcript variants encoding different isoforms have been found for this gene.
• Form: PBS, pH 7.4.
• Molecular Mass: 28 kDa
• AA Sequence: MKDFSILLMEGVPKSLNYSGVKELILAVDGVLSVHSLHIWSLTMNQVILSAHVATAASWDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD
• Purity: >90%
• Storage: Store it under sterile conditions at -20 to -80 centigrade. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Gene Information

• Gene Name: SLC30A8 solute carrier family 30 member 8 [ Homo sapiens (human) ]
• Official Symbol: SLC30A8
• Synonyms: ZNT8; ZnT-8
• Gene ID: 169026
• mRNA Refseq: NM_001172811
• Protein Refseq: NP_001166282
• MIM: 611145
• UniProt ID: Q8IWU4