Recombinant Human SLC35G5 protein, GST-tagged
| Cat.No. : | SLC35G5-8544H |
| Product Overview : | Recombinant Human SLC35G5 protein(1-36 aa), fused with N-terminal GST tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-36 aa |
| Tag : | N-GST |
| Form : | The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization. |
| Purity : | 90%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Reconstitute at 0.25 μg/μl in 200 μl sterile water for short-term storage. After reconstitution with sterile water, if glycerol has no effect on subsequent experiments, it is recommended to add an equal volume of glycerol for long-term storage. |
| AA Sequence : | MAGSHPYFNLPDSTHPSPPSAPPSLRWHQRCQPSGA |
| Gene Name | SLC35G5 solute carrier family 35, member G5 [ Homo sapiens ] |
| Official Symbol | SLC35G5 |
| Synonyms | SLC35G5; solute carrier family 35, member G5; acyl malonyl condensing enzyme 1 like 2 , AMAC, AMAC1L2; solute carrier family 35 member G5; protein AMAC1L2; acyl-malonyl condensing enzyme 1-like 2; acyl-malonyl-condensing enzyme 1-like protein 2; AMAC; AMAC1L2; |
| Gene ID | 83650 |
| mRNA Refseq | NM_054028 |
| Protein Refseq | NP_473369 |
| UniProt ID | Q96KT7 |
| ◆ Recombinant Proteins | ||
| SLC35G5-8544H | Recombinant Human SLC35G5 protein, GST-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC35G5 Products
Required fields are marked with *
My Review for All SLC35G5 Products
Required fields are marked with *
