Recombinant Human SLC8A1 Protein (396-627 aa), His-tagged
Cat.No. : | SLC8A1-2278H |
Product Overview : | Recombinant Human SLC8A1 Protein (396-627 aa) is produced by Yeast expression system. This protein is fused with a 6xHis tag at the N-terminal. Protein Description: Partial. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Yeast |
Tag : | His |
Protein Length : | 396-627 aa |
Description : | Mediates the exchange of one Ca2+ ion against three to four Na+ ions across the cell membrane, and thereby contributes to the regulation of cytoplasmic Ca2+ levels and Ca2+-dependent cellular processes (PubMed:1374913, PubMed:11241183, PubMed:1476165). Contributes to Ca2+ transport during excitation-contraction coupling in muscle. In a first phase, voltage-gated channels mediate the rapid increase of cytoplasmic Ca2+ levels due to release of Ca2+ stores from the endoplasmic reticulum. SLC8A1 mediates the export of Ca2+ from the cell during the next phase, so that cytoplasmic Ca2+ levels rapidly return to baseline. Required for normal embryonic heart development and the onset of heart contractions. |
Form : | Tris-based buffer,50% glycerol |
Molecular Mass : | 27.4 kDa |
AA Sequence : | VNTEVTENDPVSKIFFEQGTYQCLENCGTVALTIIRRGGDLTNTVFVDFRTEDGTANAGSDYEFTEGTVVFKPGDTQKEIRVGIIDDDIFEEDENFLVHLSNVKVSSEASEDGILEANHVSTLACLGSPSTATVTIFDDDHAGIFTFEEPVTHVSESIGIMEVKVLRTSGARGNVIVPYKTIEGTARGGGEDFEDTCGELEFQNDEIVKTISVKVIDDEEYEKNKTFFLEIG |
Purity : | > 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4 centigrade for up to one week. |
Storage : | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20 centigrade/-80 centigrade. The shelf life of lyophilized form is 12 months at -20 centigrade/-80 centigrade. |
Concentration : | A hardcopy of COA will be sent along with the products. Please refer to it for detailed information. |
Gene Name | SLC8A1 solute carrier family 8 (sodium/calcium exchanger), member 1 [ Homo sapiens ] |
Official Symbol | SLC8A1 |
Synonyms | NCX1; |
Gene ID | 6546 |
mRNA Refseq | NM_021097.2 |
Protein Refseq | NP_066920.1 |
MIM | 182305 |
UniProt ID | P32418 |
◆ Recombinant Proteins | ||
SLC8A1-2278H | Recombinant Human SLC8A1 Protein (396-627 aa), His-tagged | +Inquiry |
SLC8A1-4316R | Recombinant Rhesus monkey SLC8A1 Protein, His-tagged | +Inquiry |
SLC8A1-15525M | Recombinant Mouse SLC8A1 Protein | +Inquiry |
SLC8A1-8428M | Recombinant Mouse SLC8A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
SLC8A1-5581R | Recombinant Rat SLC8A1 Protein | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC8A1 Products
Required fields are marked with *
My Review for All SLC8A1 Products
Required fields are marked with *
0
Inquiry Basket