Recombinant Human SLC8A1 protein, GST-tagged
| Cat.No. : | SLC8A1-301560H |
| Product Overview : | Recombinant Human SLC8A1 protein(1-59 aa), fused with N-terminal GST tag, was expressed in E.coli. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | E.coli |
| Tag : | GST |
| Protein Length : | 1-59 aa |
| Form : | The purified protein was lyophilized from sterile phosphate-buffered saline (PBS: 58 mM Na₂HPO₄, 17 mM NaH₂PO₄, 68 mM NaCl, pH 8.0). Prior to lyophilization, 5% (w/v) trehalose and 5% (w/v) mannitol were incorporated as cryoprotective excipients. |
| AASequence : | MYNMRRLSLSPTFSMGFHLLVTVSLLFSHVDHVIAETEMEGEGNETGECTGSYYCKKGV |
| Purity : | 80%, by SDS-PAGE with Coomassie Brilliant Blue staining. |
| Storage : | Store at 2-8°C for 1-2 weeks. Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles. |
| Reconstitution : | Dissolve the product in 200 μl sterile water to achieve a working concentration of 0.25 µg/μl. If experimental compatibility allows, mix the aqueous solution with an equal volume of glycerol (1:1 ratio) after initial reconstitution. |
| Gene Name | SLC8A1 solute carrier family 8 (sodium/calcium exchanger), member 1 [ Homo sapiens ] |
| Official Symbol | SLC8A1 |
| Synonyms | NCX1 |
| Gene ID | 6546 |
| mRNA Refseq | NM_021097.2 |
| Protein Refseq | NP_066920.1 |
| MIM | 182305 |
| UniProt ID | P32418 |
| ◆ Recombinant Proteins | ||
| SLC8A1-3514C | Recombinant Chicken SLC8A1 | +Inquiry |
| SLC8A1-2278H | Recombinant Human SLC8A1 Protein (396-627 aa), His-tagged | +Inquiry |
| SLC8A1-5581R | Recombinant Rat SLC8A1 Protein | +Inquiry |
| SLC8A1-4132R | Recombinant Rhesus Macaque SLC8A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
| SLC8A1-8428M | Recombinant Mouse SLC8A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SLC8A1 Products
Required fields are marked with *
My Review for All SLC8A1 Products
Required fields are marked with *
