Recombinant Human SMIM14 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SMIM14-2569H
• Product Overview: C4orf34 MS Standard C13 and N15-labeled recombinant protein (NP_777581) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: SMIM14 (Small Integral Membrane Protein 14) is a Protein Coding gene.
• Molecular Mass: 10.7 kDa
• AA Sequence: MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAWMVIALILFLLRPPNLRGSSLPGKPTSPHNGQDPPAPPVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SMIM14 small integral membrane protein 14 [ Homo sapiens (human) ]
• Official Symbol: SMIM14
• Synonyms: SMIM14; small integral membrane protein 14; C4orf34; small integral membrane protein 14
• Gene ID: 201895
• mRNA Refseq: NM_174921
• Protein Refseq: NP_777581
• UniProt ID: Q96QK8