Recombinant Human SMIM14 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SMIM14-2569H
Product Overview : C4orf34 MS Standard C13 and N15-labeled recombinant protein (NP_777581) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : SMIM14 (Small Integral Membrane Protein 14) is a Protein Coding gene.
Molecular Mass : 10.7 kDa
AA Sequence : MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAWMVIALILFLLRPPNLRGSSLPGKPTSPHNGQDPPAPPVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SMIM14 small integral membrane protein 14 [ Homo sapiens (human) ]
Official Symbol SMIM14
Synonyms SMIM14; small integral membrane protein 14; C4orf34; small integral membrane protein 14
Gene ID 201895
mRNA Refseq NM_174921
Protein Refseq NP_777581
UniProt ID Q96QK8

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SMIM14 Products

Required fields are marked with *

My Review for All SMIM14 Products

Required fields are marked with *

0
cart-icon
0
compare icon