Recombinant Human SMIM14 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SMIM14-2569H |
Product Overview : | C4orf34 MS Standard C13 and N15-labeled recombinant protein (NP_777581) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | SMIM14 (Small Integral Membrane Protein 14) is a Protein Coding gene. |
Molecular Mass : | 10.7 kDa |
AA Sequence : | MAEGGFDPCECVCSHEHAMRRLINLLRQSQSYCTDTECLQELPGPSGDNGISVTMILVAWMVIALILFLLRPPNLRGSSLPGKPTSPHNGQDPPAPPVDTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SMIM14 small integral membrane protein 14 [ Homo sapiens (human) ] |
Official Symbol | SMIM14 |
Synonyms | SMIM14; small integral membrane protein 14; C4orf34; small integral membrane protein 14 |
Gene ID | 201895 |
mRNA Refseq | NM_174921 |
Protein Refseq | NP_777581 |
UniProt ID | Q96QK8 |
◆ Cell & Tissue Lysates | ||
SMIM14-8027HCL | Recombinant Human C4orf34 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SMIM14 Products
Required fields are marked with *
My Review for All SMIM14 Products
Required fields are marked with *