Recombinant Human SNRPC Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SNRPC-2822H
Product Overview : SNRPC MS Standard C13 and N15-labeled recombinant protein (NP_003084) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes one of the specific protein components of the U1 small nuclear ribonucleoprotein (snRNP) particle required for the formation of the spliceosome. The encoded protein participates in the processing of nuclear precursor messenger RNA splicing. snRNP particles are attacked by autoantibodies frequently produced by patients with connective tissue diseases. The genome contains several pseudogenes of this functional gene. Alternative splicing results in a non-coding transcript variant.
Molecular Mass : 17.2 kDa
AA Sequence : MPKFYCDYCDTYLTHDSPSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAFQQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHMGGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPGPPMMRPPARPMMVPTRPGMTRPDRTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SNRPC small nuclear ribonucleoprotein polypeptide C [ Homo sapiens (human) ]
Official Symbol SNRPC
Synonyms SNRPC; small nuclear ribonucleoprotein polypeptide C; U1 small nuclear ribonucleoprotein C; U1 C; Yhc1; U1 snRNP C; U1 snRNP protein C; U1 small nuclear RNP specific C; U1C; FLJ20302;
Gene ID 6631
mRNA Refseq NM_003093
Protein Refseq NP_003084
MIM 603522
UniProt ID P09234

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SNRPC Products

Required fields are marked with *

My Review for All SNRPC Products

Required fields are marked with *

0
cart-icon
0
compare icon