Recombinant Human SNRPC, His-tagged
Cat.No. : | SNRPC-30605TH |
Product Overview : | Recombinant full length Human SNRPC with an N terminal His tag; 182 aa; 19.8kDa, inclusive of tag. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 159 amino acids |
Description : | This gene encodes one of the specific protein components of the U1 small nuclear ribonucleoprotein (snRNP) particle required for the formation of the spliceosome. The encoded protein participates in the processing of nuclear precursor messenger RNA splicing. snRNP particles are attacked by autoantibodies frequently produced by patients with connective tissue diseases. The genome contains several pseudogenes of this functional gene. Alternative splicing results in a non-coding transcript variant. |
Conjugation : | HIS |
Molecular Weight : | 19.800kDa inclusive of tags |
Form : | Liquid |
Purity : | by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:0.32% Tris HCl, 50% Glycerol, 1.75% Sodium chloride, 0.08% DTT, 5.84% EDTA |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSMPKFYCDYCDTYLTHDS PSVRKTHCSGRKHKENVKDYYQKWMEEQAQSLIDKTTAAF QQGKIPPTPFSAPPPAGAMIPPPPSLPGPPRPGMMPAPHM GGPPMMPMMGPPPPGMMPVGPAPGMRPPMGGHMPMMPG PPMMRPPARPMMVPTRPGMTRPDR |
Sequence Similarities : | Belongs to the U1 small nuclear ribonucleoprotein C family.Contains 1 matrin-type zinc finger. |
Gene Name | SNRPC small nuclear ribonucleoprotein polypeptide C [ Homo sapiens ] |
Official Symbol | SNRPC |
Synonyms | SNRPC; small nuclear ribonucleoprotein polypeptide C; U1 small nuclear ribonucleoprotein C; U1 C; Yhc1; |
Gene ID | 6631 |
mRNA Refseq | NM_003093 |
Protein Refseq | NP_003084 |
MIM | 603522 |
Uniprot ID | P09234 |
Chromosome Location | 6p21 |
Pathway | Spliceosome, organism-specific biosystem; Spliceosome, conserved biosystem; Spliceosome, U1-snRNP, organism-specific biosystem; |
Function | RNA binding; NOT U1 snRNA binding; metal ion binding; nucleic acid binding; protein binding; |
◆ Recombinant Proteins | ||
SNRPC-2822H | Recombinant Human SNRPC Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
SNRPC-9525Z | Recombinant Zebrafish SNRPC | +Inquiry |
SNRPC-5307R | Recombinant Rat SNRPC Protein, His (Fc)-Avi-tagged | +Inquiry |
SNRPC-2062H | Recombinant Human SNRPC Protein, His (Fc)-Avi-tagged | +Inquiry |
SNRPC-30605TH | Recombinant Human SNRPC, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
SNRPC-616HCL | Recombinant Human SNRPC lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SNRPC Products
Required fields are marked with *
My Review for All SNRPC Products
Required fields are marked with *