Recombinant Human SOX14 Protein, Myc/DDK-tagged, C13 and N15-labeled
Cat.No. : | SOX14-6436H |
Product Overview : | SOX14 MS Standard C13 and N15-labeled recombinant protein (NP_004180) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | DDK&Myc |
Description : | This intronless gene encodes a member of the SOX (SRY-related HMG-box) family of transcription factors involved in the regulation of embryonic development and in the determination of the cell fate. The encoded protein may act as a transcriptional regulator after forming a protein complex with other proteins. Mutations in this gene are suggested to be responsible for the limb defects associated with blepharophimosis, ptosis, epicanthus inversus syndrome (BPES) and Mobius syndrome. |
Molecular Mass : | 26.5 kDa |
AA Sequence : | MSKPSDHIKRPMNAFMVWSRGQRRKMAQENPKMHNSEISKRLGAEWKLLSEAEKRPYIDEAKRLRAQHMKEHPDYKYRPRRKPKNLLKKDRYVFPLPYLGDTDPLKAAGLPVGASDGLLSAPEKARAFLPPASAPYSLLDPAQFSSSAIQKMGEVPHTLATGALPYASTLGYQNGAFGSLSCPSQHTHTHPSPTNPGYVVPCNCTAWSASTLQPPVAYILFPGMTKTGIDPYSSAHATAMSGPTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. |
Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. |
Concentration : | 50 μg/mL as determined by BCA |
Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. |
Gene Name | SOX14 SRY-box transcription factor 14 [ Homo sapiens (human) ] |
Official Symbol | SOX14 |
Synonyms | SOX14; SRY-box transcription factor 14; transcription factor SOX-14; HMG box transcription factor SOX 14; SOX28; SRY box 14; SRY-box 14; HMG box transcription factor SOX-14; MGC119898; MGC119899; |
Gene ID | 8403 |
mRNA Refseq | NM_004189 |
Protein Refseq | NP_004180 |
MIM | 604747 |
UniProt ID | O95416 |
◆ Recombinant Proteins | ||
SOX14-15776M | Recombinant Mouse SOX14 Protein | +Inquiry |
SOX14-4228R | Recombinant Rhesus Macaque SOX14 Protein, His (Fc)-Avi-tagged | +Inquiry |
SOX14-959C | Recombinant Cynomolgus SOX14 Protein, His-tagged | +Inquiry |
SOX14-3575Z | Recombinant Zebrafish SOX14 | +Inquiry |
SOX14-6325C | Recombinant Chicken SOX14 | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SOX14 Products
Required fields are marked with *
My Review for All SOX14 Products
Required fields are marked with *