Recombinant Human SPAG16 protein, His-tagged

Cat.No. : SPAG16-2892H
Product Overview : Recombinant Human SPAG16 protein(1-181 aa), fused with N-terminal His tag, was expressed in E. coli.
Availability December 15, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-181 aa
Form : The purified protein was Lyophilized from sterile PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH7.4). 5 % trehalose and 5 % mannitol are added as protectant before lyophilization.
Storage : Short-term storage: Store at 2-8°C for (1-2 weeks). Long-term storage: Aliquot and store at -20°C to -80°C for up to 3 months, reconstitution with sterile water and addition of an equal volume of glycerol. Avoid repeat freeze-thaw cycles.
AA Sequence : MAAQRGMPSSAVRVLEEALGMGLTAAGDARDTADAVAAEGAYYLEQVTITEASEDDYEYEEIPDDNFSIPEGEEDLAKAIQMAQEQATDTEILERKTVLPSKHAVPEVIEDFLCNFLIKMGMTRTLDCFQSEWYELIQKGVTELRTVGNVPDVYTQIMLLENENKNLKKDLKHYKQAAEYV
Purity : 90%, by SDS-PAGE with Coomassie Brilliant Blue staining.
Official Symbol SPAG16
Synonyms SPAG16; sperm associated antigen 16; sperm-associated antigen 16 protein; DKFZp666P1710; FLJ22724; PF20; WDR29; WD repeat domain 29; pf20 protein homolog; sperm-associated WD repeat protein; FLJ37717; MGC87036;
Gene ID 79582
mRNA Refseq NM_001025436
Protein Refseq NP_001020607
MIM 612173
UniProt ID Q8N0X2

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPAG16 Products

Required fields are marked with *

My Review for All SPAG16 Products

Required fields are marked with *

0
cart-icon
0
compare icon