Recombinant Human SPRED3 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPRED3-5457H
• Product Overview: SPRED3 MS Standard C13 and N15-labeled recombinant protein (NP_001034705) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: This gene encodes a protein with a C-terminal Sprouty-like cysteine-rich domain (SRY) and an N-terminal Ena/Vasodilator-stimulated phosphoprotein (VASP) homology-1 (EVH-1) domain. The encoded protein is a member of a family of proteins that negatively regulates mitogen-activated protein (MAP) kinase signaling, particularly during organogenesis. Alternative splicing results in multiple transcript variants.
• Molecular Mass: 16.1 kDa
• AA Sequence: MVRVRAVVMARDDSSGGWLPVGGGGLSQVSVCRVRGARPEGGARQGHYVIHGERLRDQKTTLECTLKPGLVYNKVNPIFHHWSLGDCKFGLTFQSPAEADEFQKSLLAALAALGRGSLTPSSSSSSSSPSQDTAETPCPLTLSQYFRHMLCPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPRED3 sprouty related EVH1 domain containing 3 [ Homo sapiens (human) ]
• Official Symbol: SPRED3
• Synonyms: SPRED3; sprouty-related, EVH1 domain containing 3; Eve-3; spred-3; sprouty-related, EVH1 domain-containing protein 3
• Gene ID: 399473
• mRNA Refseq: NM_001039616
• Protein Refseq: NP_001034705
• MIM: 609293
• UniProt ID: Q2MJR0