Recombinant Human SPRED3 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPRED3-5457H
Product Overview : SPRED3 MS Standard C13 and N15-labeled recombinant protein (NP_001034705) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : This gene encodes a protein with a C-terminal Sprouty-like cysteine-rich domain (SRY) and an N-terminal Ena/Vasodilator-stimulated phosphoprotein (VASP) homology-1 (EVH-1) domain. The encoded protein is a member of a family of proteins that negatively regulates mitogen-activated protein (MAP) kinase signaling, particularly during organogenesis. Alternative splicing results in multiple transcript variants.
Molecular Mass : 16.1 kDa
AA Sequence : MVRVRAVVMARDDSSGGWLPVGGGGLSQVSVCRVRGARPEGGARQGHYVIHGERLRDQKTTLECTLKPGLVYNKVNPIFHHWSLGDCKFGLTFQSPAEADEFQKSLLAALAALGRGSLTPSSSSSSSSPSQDTAETPCPLTLSQYFRHMLCPTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPRED3 sprouty related EVH1 domain containing 3 [ Homo sapiens (human) ]
Official Symbol SPRED3
Synonyms SPRED3; sprouty-related, EVH1 domain containing 3; Eve-3; spred-3; sprouty-related, EVH1 domain-containing protein 3
Gene ID 399473
mRNA Refseq NM_001039616
Protein Refseq NP_001034705
MIM 609293
UniProt ID Q2MJR0

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPRED3 Products

Required fields are marked with *

My Review for All SPRED3 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon