Recombinant Human SPRR2A Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: SPRR2A-814H
• Product Overview: SPRR2A MS Standard C13 and N15-labeled recombinant protein (NP_005979) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
• Molecular Mass: 8 kDa
• AA Sequence: MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: SPRR2A small proline rich protein 2A [ Homo sapiens (human) ]
• Official Symbol: SPRR2A
• Synonyms: SPRR2A; small proline rich protein 2A; small proline-rich protein 2A; 2-1; SPR-2A
• Gene ID: 6700
• mRNA Refseq: NM_005988
• Protein Refseq: NP_005979
• MIM: 182267
• UniProt ID: P35326