Recombinant Human SPRR2A Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | SPRR2A-814H | 
| Product Overview : | SPRR2A MS Standard C13 and N15-labeled recombinant protein (NP_005979) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane. | 
| Molecular Mass : | 8 kDa | 
| AA Sequence : | MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | SPRR2A small proline rich protein 2A [ Homo sapiens (human) ] | 
| Official Symbol | SPRR2A | 
| Synonyms | SPRR2A; small proline rich protein 2A; small proline-rich protein 2A; 2-1; SPR-2A | 
| Gene ID | 6700 | 
| mRNA Refseq | NM_005988 | 
| Protein Refseq | NP_005979 | 
| MIM | 182267 | 
| UniProt ID | P35326 | 
| ◆ Recombinant Proteins | ||
| SPRR2A-2729H | Recombinant Human SPRR2A Protein, His-tagged | +Inquiry | 
| SPRR2A-814H | Recombinant Human SPRR2A Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| Sprr2a-3522M | Recombinant Mouse Sprr2a protein, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| SPRR2A-1494HCL | Recombinant Human SPRR2A 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All SPRR2A Products
Required fields are marked with *
My Review for All SPRR2A Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            