Recombinant Human SPRR2A Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : SPRR2A-814H
Product Overview : SPRR2A MS Standard C13 and N15-labeled recombinant protein (NP_005979) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Cross-linked envelope protein of keratinocytes. It is a keratinocyte protein that first appears in the cell cytosol, but ultimately becomes cross-linked to membrane proteins by transglutaminase. All that results in the formation of an insoluble envelope beneath the plasma membrane.
Molecular Mass : 8 kDa
AA Sequence : MSYQQQQCKQPCQPPPVCPTPKCPEPCPPPKCPEPCPPPKCPQPCPPQQCQQKYPPVTPSPPCQSKYPPKSKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name SPRR2A small proline rich protein 2A [ Homo sapiens (human) ]
Official Symbol SPRR2A
Synonyms SPRR2A; small proline rich protein 2A; small proline-rich protein 2A; 2-1; SPR-2A
Gene ID 6700
mRNA Refseq NM_005988
Protein Refseq NP_005979
MIM 182267
UniProt ID P35326

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SPRR2A Products

Required fields are marked with *

My Review for All SPRR2A Products

Required fields are marked with *

0

Inquiry Basket

cartIcon