Recombinant Human SRSF7 protein, His-tagged

Cat.No. : SRSF7-22H
Product Overview : Recombinant Human SRSF7 protein(Q16629)(1-238 aa), fused with His tag, was expressed in E. coli.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : His
Protein Length : 1-238 aa
Form : Lyophilized from 10 mM Tris-HCl, 1 mM EDTA, 6% Trehalose, pH 8.0.
The volume before lyophilization is 20μl/vial.
Molecular Mass : Predicted band size: 33.3 kDa
AA Sequence : MSRYGRYGGETKVYVGNLGTGAGKGELERAFSYYGPLRTVWIARNPPGFAFVEFEDPRDAEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCHRYSRRRRSRSRSRSHSRSRGRRYSRSRSRSRGRRSRSASPRRSRSISLRRSRSASLRRSRSGSIKGSRYFQSPSRSRSRSRSISRPRSSRSKSRSPSPKRSRSPSGSPRRSASPERMD
Purity : ≥85%, by SDS-PAGE quantitative densitometry by Coomassie Blue Staining.
Storage : Store at -20°C, for extended storage, conserve at -20°C or -80°C.
Reconstitution : We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Gene Name SRSF7 serine/arginine-rich splicing factor 7 [ Homo sapiens ]
Official Symbol SRSF7
Synonyms SRSF7; serine/arginine-rich splicing factor 7; SFRS7, splicing factor, arginine/serine rich 7 (35kD) , splicing factor, arginine/serine rich 7, 35kDa; 9G8; AAG3; HSSG1; RBM37; SR splicing factor 7; ZCCHC20; ZCRB2; splicing factor 9G8; aging-associated protein 3; splicing factor, arginine/serine-rich 7, 35kDa; SFRS7
Gene ID 6432
mRNA Refseq NM_001031684
Protein Refseq NP_001026854
MIM 600572
UniProt ID Q16629

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SRSF7 Products

Required fields are marked with *

My Review for All SRSF7 Products

Required fields are marked with *

0
cart-icon
0
compare icon