Recombinant Human SRSF9 protein, GST-tagged

Cat.No. : SRSF9-10H
Product Overview : Recombinant Human SRSF9(1-221aa) fused with GST tag at N-terminal was expressed in E. coli.
Availability July 06, 2025
Unit
Price
Qty
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : E.coli
Tag : GST
Protein Length : 1-221 a.a.
Description : The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an RNA recognition motif (RRM) for binding RNA and an RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Two pseudogenes, one on chromosome 15 and the other on chromosome 21, have been found for this gene.
Form : 1M PBS (58 mM Na2HPO4, 17 mM NaH2PO4, 68 mM NaCl, pH8.0 ), 100 mM GSH and 1% Triton X-100, 15% glycerol.
AA Sequence : MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGY DYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMV EYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY
Storage : Aliquot and store at -20 centigrade to -80 centigrade for up to 6 months. Avoid freeze thaw cycles.
Shipping : The product is shipped with ice packs. Upon receipt, store it immediately at -20 centigrade to -80 centigrade.
Gene Name SRSF9 serine/arginine-rich splicing factor 9 [ Homo sapiens ]
Official Symbol SRSF9
Synonyms SFRS9; SRp30c
Gene ID 8683
mRNA Refseq NM_003769.2
Protein Refseq NP_003760.1
MIM 601943
UniProt ID Q13242
Chromosome Location 12q24.31
Pathway Cleavage of Growing Transcript in the Termination Region, organism-specific biosystem;Gene expression, organism-specific biosystem;Herpes simplex infection, organism-specific biosystem;Herpes simplex infection, conserved biosystem;Processing of Capped Intron-Containing Pre-mRNA, organism-specific biosystem;RNA Polymerase II Transcription, organism-specific biosystem;RNA Polymerase II Transcription Termination, organism-specific biosystem;
Function RNA binding;nucleotide binding;

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All SRSF9 Products

Required fields are marked with *

My Review for All SRSF9 Products

Required fields are marked with *

0
cart-icon